Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMEM49Sample Tissue: Mouse RAW264.7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse TMEM49 Polyclonal Antibody | anti-TMEM49 antibody

TMEM49 Antibody-C-terminal region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM49; Polyclonal Antibody; TMEM49 Antibody-C-terminal region; vacuole membrane protein 1; ni-2; Tango5; Tmem49; mir-21a; AI787464; 3110098I04Rik; 4930579A11Rik; anti-TMEM49 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
TPQGENWLSWMFEKLVVAMVCYFVLSIINSMAQNYAKRIQQRLNSEEKTK
Applicable Applications for anti-TMEM49 antibody
Western Blot (WB)
Protein Size
406 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TMEM49
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMEM49Sample Tissue: Mouse RAW264.7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMEM49Sample Tissue: Mouse RAW264.7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TMEM49 antibody
Description of Target: Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions (By similarity). Plays a role in the initial stages of the autophagic process through its interaction with BECN1.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
46kDa
UniProt Protein Name
Vacuole membrane protein 1
UniProt Gene Name
Vmp1
UniProt Synonym Gene Names
Tmem49; Protein ni-2
UniProt Entry Name
VMP1_MOUSE

Uniprot Description

VMP1: Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1. Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions. Interacts with BECN1. Interacts with TJP1. Interacts with TP53INP2. Belongs to the VMP1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Endoplasmic reticulum

Cellular Component: endoplasmic reticulum; integral to membrane; membrane; nucleolus; plasma membrane; vacuole

Biological Process: autophagy; cell adhesion; cell-cell adhesion; embryo implantation; endoplasmic reticulum organization and biogenesis; exocytosis; Golgi organization and biogenesis; regulation of autophagy

Similar Products

Product Notes

The TMEM49 vmp1 (Catalog #AAA3249893) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM49 Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM49 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM49 vmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TPQGENWLSW MFEKLVVAMV CYFVLSIINS MAQNYAKRIQ QRLNSEEKTK. It is sometimes possible for the material contained within the vial of "TMEM49, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.