Rabbit TMEM48 Polyclonal Antibody | anti-TMEM48 antibody
TMEM48 antibody
Gene Names
NDC1; NET3; TMEM48
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM48; Polyclonal Antibody; TMEM48 antibody; Polyclonal TMEM48; Anti-TMEM48; TMEM 48; RP4-654H19.1; TMEM-48; FLJ12556; FLJ34120; Transmembrane Protein 48; FLJ10407; NDC1; anti-TMEM48 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
TMEM48 antibody was raised against the middle region of TMEM48
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM48 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
644
Applicable Applications for anti-TMEM48 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.
Cross-Reactivity
Human
Immunogen
TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-TMEM48 antibody
Rabbit polyclonal TMEM48 antibody raised against the middle region of TMEM48
Product Categories/Family for anti-TMEM48 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
76 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 48, isoform CRA_c
NCBI Official Synonym Full Names
NDC1 transmembrane nucleoporin
NCBI Official Symbol
NDC1
NCBI Official Synonym Symbols
NET3; TMEM48
NCBI Protein Information
nucleoporin NDC1
UniProt Protein Name
Nucleoporin NDC1
UniProt Gene Name
NDC1
UniProt Synonym Gene Names
TMEM48; hNDC1
UniProt Entry Name
NDC1_HUMAN
Uniprot Description
TMEM48: Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. Required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane. Belongs to the NDC1 family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Nucleoporin; Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1p32.3
Cellular Component: nuclear membrane; membrane; cytoplasm; nuclear pore
Molecular Function: structural constituent of nuclear pore
Biological Process: nuclear pore complex assembly; protein transport; mRNA transport; synapsis; nuclear pore distribution; spermatogenesis
Research Articles on TMEM48
Similar Products
Product Notes
The TMEM48 ndc1 (Catalog #AAA5301049) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMEM48 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM48 ndc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM48, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
