Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMEM16K antibody (MBS5303453) used at 1 ug/ml to detect target protein.)

Rabbit TMEM16K Polyclonal Antibody | anti-TMEM16K antibody

TMEM16K antibody

Gene Names
ANO10; SCAR10; TMEM16K
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM16K; Polyclonal Antibody; TMEM16K antibody; Polyclonal TMEM16K; Anti-TMEM16K; TMEMK 16; Transmembrane Protein 16K; TMEMK-16; MGC47890; FLJ10375; anti-TMEM16K antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
TMEM16K antibody was raised against the C terminal of TMEM16K
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM16K antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
660
Applicable Applications for anti-TMEM16K antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
TMEM16K antibody was raised using the C terminal of TMEM16K corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(TMEM16K antibody (MBS5303453) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (TMEM16K antibody (MBS5303453) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM16K antibody
Rabbit polyclonal TMEM16K antibody raised against the C terminal of TMEM16K
Product Categories/Family for anti-TMEM16K antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
76 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 16K, isoform CRA_b
NCBI Official Synonym Full Names
anoctamin 10
NCBI Official Symbol
ANO10
NCBI Official Synonym Symbols
SCAR10; TMEM16K
NCBI Protein Information
anoctamin-10
UniProt Protein Name
Anoctamin-10
UniProt Gene Name
ANO10
UniProt Synonym Gene Names
TMEM16K
UniProt Entry Name
ANO10_HUMAN

NCBI Description

The transmembrane protein encoded by this gene is a member of a family of calcium-activated chloride channels. Defects in this gene may be a cause of autosomal recessive spinocerebellar ataxia-10. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

ANO10: May act as a calcium-activated chloride channel. Defects in ANO10 are the cause of spinocerebellar ataxia autosomal recessive type 10 (SCAR10). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCAR10 is characterized by onset in the teenage or young adult years of gait and limb ataxia, dysarthria, and nystagmus associated with marked cerebellar atrophy on brain imaging. Belongs to the anoctamin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, ion channel

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: membrane; integral to membrane; plasma membrane; intracellular

Molecular Function: intracellular calcium activated chloride channel activity; calcium activated cation channel activity

Biological Process: chloride transport; transmembrane transport; cation transport

Disease: Spinocerebellar Ataxia, Autosomal Recessive 10

Research Articles on TMEM16K

Similar Products

Product Notes

The TMEM16K ano10 (Catalog #AAA5303453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM16K antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM16K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM16K ano10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM16K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.