Western Blot (WB)
(Host: RabbitTarget Name: TMED7Sample Type: Ovary Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human TMED7 Polyclonal Antibody | anti-TMED7 antibody
TMED7 Antibody - C-terminal region
Gene Names
TMED7; p27; p24g3; CGI-109; p24gamma3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMED7; Polyclonal Antibody; TMED7 Antibody - C-terminal region; anti-TMED7 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSV
Sequence Length
224
Applicable Applications for anti-TMED7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMED7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TMED7Sample Type: Ovary Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TMED7Sample Type: Ovary Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TMED7 antibody
This is a rabbit polyclonal antibody against TMED7. It was validated on Western Blot
Target Description: This locus represents naturally occurring read-through transcription between the neighboring transmembrane emp24 protein transport domain containing 7 (TMED7) and toll-like receptor adaptor molecule 2 (TICAM2) genes. Alternative splicing results in multiple transcript variants, one of which encodes a fusion protein that shares sequence identity with the products of each individual gene. This fusion product functions to negatively regulate the adaptor MyD88-independent toll-like receptor 4 pathway.
Target Description: This locus represents naturally occurring read-through transcription between the neighboring transmembrane emp24 protein transport domain containing 7 (TMED7) and toll-like receptor adaptor molecule 2 (TICAM2) genes. Alternative splicing results in multiple transcript variants, one of which encodes a fusion protein that shares sequence identity with the products of each individual gene. This fusion product functions to negatively regulate the adaptor MyD88-independent toll-like receptor 4 pathway.
Product Categories/Family for anti-TMED7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
transmembrane emp24 domain-containing protein 7
NCBI Official Synonym Full Names
transmembrane p24 trafficking protein 7
NCBI Official Symbol
TMED7
NCBI Official Synonym Symbols
p27; p24g3; CGI-109; p24gamma3
NCBI Protein Information
transmembrane emp24 domain-containing protein 7
UniProt Protein Name
Transmembrane emp24 domain-containing protein 7
Protein Family
UniProt Gene Name
TMED7
UniProt Synonym Gene Names
p24gamma3
UniProt Entry Name
TMED7_HUMAN
Research Articles on TMED7
Similar Products
Product Notes
The TMED7 tmed7 (Catalog #AAA3220056) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMED7 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMED7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMED7 tmed7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SALTQMESAC VSIHEALKSV IDYQTHFRLR EAQGRSRAED LNTRVAYWSV. It is sometimes possible for the material contained within the vial of "TMED7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
