Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TMED6 expression in transfected 293T cell line by TMED6 polyclonal antibody. Lane 1: TMED6 transfected lysate (26.4kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TMED6 Polyclonal Antibody | anti-Tmed6 antibody

TMED6 (Transmembrane Emp24 Domain-containing Protein 6, p24 Family Protein gamma-5, p24gamma5, SPLL9146, UNQ9146/PRO34237)

Gene Names
Tmed6; 1810015P03Rik; 1810018I24Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TMED6; Polyclonal Antibody; TMED6 (Transmembrane Emp24 Domain-containing Protein 6; p24 Family Protein gamma-5; p24gamma5; SPLL9146; UNQ9146/PRO34237); Anti -TMED6 (Transmembrane Emp24 Domain-containing Protein 6; anti-Tmed6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMED6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC
Applicable Applications for anti-Tmed6 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TMED6, aa1-240 (NP_653277.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TMED6 expression in transfected 293T cell line by TMED6 polyclonal antibody. Lane 1: TMED6 transfected lysate (26.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TMED6 expression in transfected 293T cell line by TMED6 polyclonal antibody. Lane 1: TMED6 transfected lysate (26.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-Tmed6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,673 Da
NCBI Official Full Name
transmembrane emp24 domain-containing protein 6
NCBI Official Synonym Full Names
transmembrane emp24 protein transport domain containing 6
NCBI Official Symbol
Tmed6
NCBI Official Synonym Symbols
1810015P03Rik; 1810018I24Rik
NCBI Protein Information
transmembrane emp24 domain-containing protein 6; p24gamma5; p24 family protein gamma-5
UniProt Protein Name
Transmembrane emp24 domain-containing protein 6
UniProt Gene Name
Tmed6
UniProt Synonym Gene Names
p24gamma5
UniProt Entry Name
TMED6_MOUSE

Uniprot Description

TMED6: Belongs to the EMP24/GP25L family.

Protein type: Membrane protein, integral

Cellular Component: membrane; endoplasmic reticulum; integral to membrane

Biological Process: transport

Research Articles on Tmed6

Similar Products

Product Notes

The Tmed6 tmed6 (Catalog #AAA6002846) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMED6 (Transmembrane Emp24 Domain-containing Protein 6, p24 Family Protein gamma-5, p24gamma5, SPLL9146, UNQ9146/PRO34237) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMED6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Tmed6 tmed6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSPLLFGAGL VVLNLVTSAR SQKTEPLSGS GDQPLFRGAD RYDFAIMIPP GGTECFWQFA HQTGYFYFSC EVQRTVGMSH DRHVAATAHN PQGFLIDTSQ GVRGQINFST QETGFYQLCL SNQHNHFGSV QVYLNFGVFY EGPETDHKQK ERKQLNDTLD AIEDGTQKVQ NNIFHMWRYY NFARMRKMAD FFLIQSNYNY VNWWSTAQSL VIILSGILQL YFLKRLFNVP TTTDTKKPRC. It is sometimes possible for the material contained within the vial of "TMED6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.