Western Blot (WB)
(WB Suggested Anti-TLX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)
Rabbit TLX3 Polyclonal Antibody | anti-TLX3 antibody
TLX3 antibody - N-terminal region
Gene Names
TLX3; RNX; HOX11L2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TLX3; Polyclonal Antibody; TLX3 antibody - N-terminal region; anti-TLX3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGG
Sequence Length
291
Applicable Applications for anti-TLX3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TLX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TLX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)
Western Blot (WB)
(WB Suggested Anti-TLX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)
Related Product Information for anti-TLX3 antibody
This is a rabbit polyclonal antibody against TLX3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain.
Target Description: RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain.
Product Categories/Family for anti-TLX3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
T-cell leukemia homeobox protein 3
NCBI Official Synonym Full Names
T cell leukemia homeobox 3
NCBI Official Symbol
TLX3
NCBI Official Synonym Symbols
RNX; HOX11L2
NCBI Protein Information
T-cell leukemia homeobox protein 3
UniProt Protein Name
T-cell leukemia homeobox protein 3
Protein Family
UniProt Gene Name
TLX3
UniProt Synonym Gene Names
HOX11L2
UniProt Entry Name
TLX3_HUMAN
NCBI Description
The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and young adults. [provided by RefSeq, Nov 2015]
Uniprot Description
TLX3:
Protein type: Transcription factor; Cell development/differentiation; DNA-binding
Chromosomal Location of Human Ortholog: 5q35.1
Cellular Component: nucleus
Molecular Function: protein binding; sequence-specific DNA binding
Biological Process: negative regulation of neuron differentiation; central nervous system development; regulation of transcription, DNA-dependent; neuron migration; neuron fate specification; neurological control of breathing; respiratory gaseous exchange
Research Articles on TLX3
Similar Products
Product Notes
The TLX3 tlx3 (Catalog #AAA3200647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TLX3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TLX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TLX3 tlx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEAPASAQTP HPHEPISFGI DQILNSPDQD SAPAPRGPDG ASYLGGPPGG. It is sometimes possible for the material contained within the vial of "TLX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
