Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit TLE1 Polyclonal Antibody | anti-TLE1 antibody

TLE1 antibody - N-terminal region

Gene Names
TLE1; ESG; ESG1; GRG1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TLE1; Polyclonal Antibody; TLE1 antibody - N-terminal region; anti-TLE1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASP
Sequence Length
770
Applicable Applications for anti-TLE1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TLE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TLE1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TLE1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TLE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Related Product Information for anti-TLE1 antibody
This is a rabbit polyclonal antibody against TLE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TLE1 is a transcriptional corepressor that binds to a number of transcription factors. TLE1 inhibits NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. TLE1 has an unusual function as coactivator for ESRRG.
Product Categories/Family for anti-TLE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
transducin-like enhancer protein 1 isoform 2
NCBI Official Synonym Full Names
TLE family member 1, transcriptional corepressor
NCBI Official Symbol
TLE1
NCBI Official Synonym Symbols
ESG; ESG1; GRG1
NCBI Protein Information
transducin-like enhancer protein 1
UniProt Protein Name
Transducin-like enhancer protein 1
UniProt Gene Name
TLE1
UniProt Synonym Gene Names
ESG1
UniProt Entry Name
TLE1_HUMAN

Uniprot Description

Function: Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG. Ref.13

Subunit structure: Homooligomer and heterooligomer with other family members. Binds LEF1, RUNX1, RUNX3, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif). Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16

Subcellular location: Nucleus. Note: Nuclear and chromatin-associated, depending on isoforms and phosphorylation status. Hyperphosphorylation decreases the affinity for nuclear components. Ref.15

Tissue specificity: In all tissues examined, mostly in brain, liver and muscle.

Post-translational modification: Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1. Ref.15Ubiquitinated by XIAP/BIRC4. Ref.21

Sequence similarities: Belongs to the WD repeat Groucho/TLE family.Contains 6 WD repeats.

Research Articles on TLE1

Similar Products

Product Notes

The TLE1 tle1 (Catalog #AAA3200885) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TLE1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TLE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TLE1 tle1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNGPEFSNDI KKRKVDDKDS SHYDSDGDKS DDNLVVDVSN EDPSSPRASP. It is sometimes possible for the material contained within the vial of "TLE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual