Rabbit TLE1 Polyclonal Antibody | anti-TLE1 antibody

TLE1 antibody - N-terminal region

Cat. Num. AAA3200885

• Gene Names: TLE1; ESG; ESG1; GRG1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: TLE1; Polyclonal Antibody; TLE1 antibody - N-terminal region; anti-TLE1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASP
• Sequence Length: 770

• Applicable Applications for anti-TLE1 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLE1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TLE1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TLE1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TLE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Related Product Information for anti-TLE1 antibody

This is a rabbit polyclonal antibody against TLE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TLE1 is a transcriptional corepressor that binds to a number of transcription factors. TLE1 inhibits NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. TLE1 has an unusual function as coactivator for ESRRG.

Product Categories/Family for anti-TLE1 antibody

Polyclonal; Transcription Regulation; Various; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 21541824
• NCBI GeneID: 7088
• NCBI Accession #: NP_005068
• NCBI GenBank Nucleotide #: NM_005077
• UniProt Accession #: Q04724
• Molecular Weight: 83kDa
• NCBI Official Full Name: transducin-like enhancer protein 1 isoform 2
• NCBI Official Synonym Full Names: TLE family member 1, transcriptional corepressor
• NCBI Official Symbol: TLE1
• NCBI Official Synonym Symbols: ESG; ESG1; GRG1
• NCBI Protein Information: transducin-like enhancer protein 1
• UniProt Protein Name: Transducin-like enhancer protein 1
• Protein Family: Transducin-like enhancer protein
• UniProt Gene Name: TLE1
• UniProt Synonym Gene Names: ESG1
• UniProt Entry Name: TLE1_HUMAN

Uniprot Description

Function: Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG. Ref.13

Subunit structure: Homooligomer and heterooligomer with other family members. Binds LEF1, RUNX1, RUNX3, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif). Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.16

Subcellular location: Nucleus. Note: Nuclear and chromatin-associated, depending on isoforms and phosphorylation status. Hyperphosphorylation decreases the affinity for nuclear components. Ref.15

Tissue specificity: In all tissues examined, mostly in brain, liver and muscle.

Post-translational modification: Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1. Ref.15Ubiquitinated by XIAP/BIRC4. Ref.21

Sequence similarities: Belongs to the WD repeat Groucho/TLE family.Contains 6 WD repeats.