Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TIPIN Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateTIPIN is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit TIPIN Polyclonal Antibody | anti-TIPIN antibody

TIPIN antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
TIPIN; Polyclonal Antibody; TIPIN antibody - N-terminal region; anti-TIPIN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGA
Sequence Length
301
Applicable Applications for anti-TIPIN antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TIPIN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TIPIN Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateTIPIN is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-TIPIN Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateTIPIN is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-TIPIN antibody
This is a rabbit polyclonal antibody against TIPIN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TIPIN is required for normal progression of S-phase. It is important for cell survival after DNA damage or replication stress and may be specifically required for the ATR-CHK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light.
Product Categories/Family for anti-TIPIN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
TIMELESS-interacting protein isoform 1
NCBI Official Synonym Full Names
TIMELESS interacting protein
NCBI Official Symbol
TIPIN
NCBI Protein Information
TIMELESS-interacting protein
UniProt Protein Name
TIMELESS-interacting protein
UniProt Gene Name
TIPIN
UniProt Entry Name
TIPIN_HUMAN

NCBI Description

The protein encoded by this gene is part of the replisome complex, a group of proteins that support DNA replication. It binds TIM, which is involved in circadian rhythm regulation, and aids in protecting cells against DNA damage and stress. Two pseudogenes and two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

TIPIN: Required for normal progression of S-phase. Important for cell survival after DNA damage or replication stress. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Belongs to the CSM3 family.

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; nuclear chromatin; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: mitosis; intra-S DNA damage checkpoint; cell division; positive regulation of cell proliferation; replication fork protection; DNA replication checkpoint; regulation of DNA replication during S phase; response to UV

Research Articles on TIPIN

Similar Products

Product Notes

The TIPIN tipin (Catalog #AAA3210014) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIPIN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TIPIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TIPIN tipin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLEPQENGVI DLPDYEHVED ETFPPFPPPA SPERQDGEGT EPDEESGNGA. It is sometimes possible for the material contained within the vial of "TIPIN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.