Western Blot (WB)
(TIMM22 polyclonal antibody. Western Blot analysis of TIMM22 expression in human pancreas.)
Mouse anti-Human TIMM22 Polyclonal Antibody | anti-Timm22 antibody
TIMM22 (Mitochondrial Import Inner Membrane Translocase Subunit Tim22, TIM22, Testis-expressed Sequence 4, TEX4)
Gene Names
Timm22; Tim22; 2610511O07Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TIMM22; Polyclonal Antibody; TIMM22 (Mitochondrial Import Inner Membrane Translocase Subunit Tim22; TIM22; Testis-expressed Sequence 4; TEX4); Anti -TIMM22 (Mitochondrial Import Inner Membrane Translocase Subunit Tim22; anti-Timm22 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TIMM22.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR
Applicable Applications for anti-Timm22 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TIMM22, aa1-194 (NP_037469).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(TIMM22 polyclonal antibody. Western Blot analysis of TIMM22 expression in human pancreas.)
Western Blot (WB)
(TIMM22 polyclonal antibody. Western Blot analysis of TIMM22 expression in human pancreas.)
Western Blot (WB)
(Western Blot analysis of TIMM22 expression in transfected 293T cell line by TIMM22 polyclonal antibody. Lane 1: TIMM22 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TIMM22 expression in transfected 293T cell line by TIMM22 polyclonal antibody. Lane 1: TIMM22 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-Timm22 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
20,114 Da
NCBI Official Full Name
Timm22 protein, partial
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 22
NCBI Official Symbol
Timm22
NCBI Official Synonym Symbols
Tim22; 2610511O07Rik
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim22; preprotein translocase; translocase of inner mitochondrial membrane 22 homolog
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit Tim22
Protein Family
UniProt Gene Name
Timm22
UniProt Synonym Gene Names
Tim22
UniProt Entry Name
TIM22_MOUSE
Uniprot Description
TIMM22: Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps. Belongs to the Tim17/Tim22/Tim23 family.
Protein type: Membrane protein, multi-pass; Mitochondrial; Membrane protein, integral
Cellular Component: mitochondrion; membrane; mitochondrial inner membrane; integral to membrane
Molecular Function: protein binding
Biological Process: protein transport; transport
Similar Products
Product Notes
The Timm22 timm22 (Catalog #AAA6009877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TIMM22 (Mitochondrial Import Inner Membrane Translocase Subunit Tim22, TIM22, Testis-expressed Sequence 4, TEX4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Timm22 timm22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAAAPNAGG SAPETAGSAE APLQYSLLLQ YLVGDKRQPR LLEPGSLGGI PSPAKSEEQK MIEKAMESCA FKAALACVGG FVLGGAFGVF TAGIDTNVGF DPKDPYRTPT AKEVLKDMGQ RGMSYAKNFA IVGAMFSCTE CLIESYRGTS DWKNSVISGC ITGGAIGFRA GLKAGAIGCG GFAAFSAAID YYLR. It is sometimes possible for the material contained within the vial of "TIMM22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
