Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-THOC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Pancreas)

Rabbit THOC6 Polyclonal Antibody | anti-THOC6 antibody

THOC6 antibody - middle region

Gene Names
THOC6; WDR58; fSAP35
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THOC6; Polyclonal Antibody; THOC6 antibody - middle region; anti-THOC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR
Sequence Length
341
Applicable Applications for anti-THOC6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human THOC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-THOC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Pancreas)

Western Blot (WB) (WB Suggested Anti-THOC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Pancreas)
Related Product Information for anti-THOC6 antibody
This is a rabbit polyclonal antibody against THOC6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.
Product Categories/Family for anti-THOC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
THO complex subunit 6 homolog isoform 1
NCBI Official Synonym Full Names
THO complex 6
NCBI Official Symbol
THOC6
NCBI Official Synonym Symbols
WDR58; fSAP35
NCBI Protein Information
THO complex subunit 6 homolog
UniProt Protein Name
THO complex subunit 6 homolog
Protein Family
UniProt Gene Name
THOC6
UniProt Synonym Gene Names
WDR58; fSAP35
UniProt Entry Name
THOC6_HUMAN

NCBI Description

This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and export of mRNAs. A missense mutation in this gene is associated with a neurodevelopmental disorder called Beaulieu-Boycott-Innes syndrome. [provided by RefSeq, Dec 2016]

Uniprot Description

THOC6: Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and ALYREF/THOC4. Belongs to the WD repeat THOC6 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; nuclear speck; nucleus

Molecular Function: RNA binding

Biological Process: mRNA export from nucleus; central nervous system development; apoptosis; RNA splicing; intronless viral mRNA export from host nucleus; mRNA processing; negative regulation of apoptosis

Disease: Beaulieu-boycott-innes Syndrome

Research Articles on THOC6

Similar Products

Product Notes

The THOC6 thoc6 (Catalog #AAA3209000) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THOC6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's THOC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THOC6 thoc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGGDCQLHTM DLETGTFTRV LRGHTDYIHC LALRERSPEV LSGGEDGAVR. It is sometimes possible for the material contained within the vial of "THOC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.