Western Blot (WB)
(Host: RabbitTarget Name: THOC5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human THOC5 Polyclonal Antibody | anti-THOC5 antibody
THOC5 Antibody - N-terminal region
Gene Names
THOC5; Fmip; PK1.3; fSAP79; C22orf19
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THOC5; Polyclonal Antibody; THOC5 Antibody - N-terminal region; anti-THOC5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDA
Sequence Length
683
Applicable Applications for anti-THOC5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human THOC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: THOC5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: THOC5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-THOC5 antibody
This is a rabbit polyclonal antibody against THOC5. It was validated on Western Blot
Target Description: THOC5 regulates the expression of myeloid transcription factors CEBPA, CEBPB and GAB2 by enhancing the levels of phosphatidylinositol 3,4,5-trisphosphate. It may be involved in the differentiation of granulocytes and adipocytes. It essential for hematopoietic primitive cell survival and plays an integral role in monocytic development.
Target Description: THOC5 regulates the expression of myeloid transcription factors CEBPA, CEBPB and GAB2 by enhancing the levels of phosphatidylinositol 3,4,5-trisphosphate. It may be involved in the differentiation of granulocytes and adipocytes. It essential for hematopoietic primitive cell survival and plays an integral role in monocytic development.
Product Categories/Family for anti-THOC5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
THO complex subunit 5 homolog
NCBI Official Synonym Full Names
THO complex 5
NCBI Official Symbol
THOC5
NCBI Official Synonym Symbols
Fmip; PK1.3; fSAP79; C22orf19
NCBI Protein Information
THO complex subunit 5 homolog
UniProt Protein Name
THO complex subunit 5 homolog
Protein Family
UniProt Gene Name
THOC5
UniProt Synonym Gene Names
C22orf19; KIAA0983; fSAP79; PP39.2
UniProt Entry Name
THOC5_HUMAN
Uniprot Description
FMIP: a Fms-interacting protein. Binds transiently to activated Fms. Phosphorylation by protein kinase C has been reported to potentiates M-CSF-mediated differentiation. Overexpression inhibited M-CSF induced macrophage differentiation and enhanced granulocytic differentiation.
Protein type: RNA splicing; Spliceosome; Cell development/differentiation
Chromosomal Location of Human Ortholog: 22q12.2
Cellular Component: nucleoplasm; cytoplasm; nuclear speck; nucleus
Molecular Function: mRNA binding; protein binding
Biological Process: blastocyst development; mRNA export from nucleus; monocyte differentiation; negative regulation of macrophage differentiation; positive regulation of RNA elongation; stem cell division; RNA splicing; cell morphogenesis; intronless viral mRNA export from host nucleus; mRNA processing
Research Articles on THOC5
Similar Products
Product Notes
The THOC5 thoc5 (Catalog #AAA3215580) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THOC5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THOC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THOC5 thoc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGKDVAIEIE ERRIQSCVHF MTLKKLNRLA HIRLKKGRDQ THEAKQKVDA. It is sometimes possible for the material contained within the vial of "THOC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
