Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (THAP1 rabbit polyclonal antibody. Western Blot analysis of THAP1 expression in Jurkat.)

Rabbit anti-Human THAP1 Polyclonal Antibody | anti-THAP1 antibody

THAP1 (THAP Domain-containing Protein 1, 4833431A01Rik, DYT6, FLJ10477, MGC33014) (AP)

Gene Names
THAP1; DYT6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
THAP1; Polyclonal Antibody; THAP1 (THAP Domain-containing Protein 1; 4833431A01Rik; DYT6; FLJ10477; MGC33014) (AP); anti-THAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human THAP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-THAP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human THAP1, aa1-213 (NP_060575.1).
Immunogen Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(THAP1 rabbit polyclonal antibody. Western Blot analysis of THAP1 expression in Jurkat.)

Western Blot (WB) (THAP1 rabbit polyclonal antibody. Western Blot analysis of THAP1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of THAP1 expression in transfected 293T cell line by THAP1 polyclonal antibody. Lane 1: THAP1 transfected lysate (24.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of THAP1 expression in transfected 293T cell line by THAP1 polyclonal antibody. Lane 1: THAP1 transfected lysate (24.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-THAP1 antibody
DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. Specifically binds the 5'-[AT]NTNN[GT]GGCA[AGT]-3' core DNA sequence and acts by modulating expression of pRB-E2F cell-cycle target genes, including RRM1. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. May also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis.
Product Categories/Family for anti-THAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,493 Da
NCBI Official Full Name
THAP domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
THAP domain containing, apoptosis associated protein 1
NCBI Official Symbol
THAP1
NCBI Official Synonym Symbols
DYT6
NCBI Protein Information
THAP domain-containing protein 1; 4833431A01Rik; THAP domain protein 1; nuclear proapoptotic factor
UniProt Protein Name
THAP domain-containing protein 1
UniProt Gene Name
THAP1
UniProt Entry Name
THAP1_HUMAN

NCBI Description

The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

THAP1: DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. Specifically binds the 5'-[AT]NTNN[GT]GGCA[AGT]-3' core DNA sequence and acts by modulating expression of pRB-E2F cell-cycle target genes, including RRM1. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. May also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis. Defects in THAP1 are the cause of dystonia type 6 (DYT6). DYT6 is a primary torsion dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Dystonia type 6 is characterized by onset in early adulthood, cranial or cervical involvement in about half of the cases, and frequent progression to involve multiple body regions. Belongs to the THAP1 family.

Protein type: Transcription factor; DNA-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 8p11.21

Cellular Component: PML body; nucleus

Molecular Function: protein binding; zinc ion binding; sequence-specific DNA binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; endothelial cell proliferation; regulation of mitotic cell cycle; cell cycle

Disease: Dystonia 6, Torsion

Research Articles on THAP1

Similar Products

Product Notes

The THAP1 thap1 (Catalog #AAA6396456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THAP1 (THAP Domain-containing Protein 1, 4833431A01Rik, DYT6, FLJ10477, MGC33014) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the THAP1 thap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "THAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.