Western Blot (WB)
(WB Suggested Anti-TGIF2LX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Rabbit TGIF2LX Polyclonal Antibody | anti-TGIF2LX antibody
TGIF2LX antibody - middle region
Gene Names
TGIF2LX; TGIFLX
Reactivity
Dog, Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TGIF2LX; Polyclonal Antibody; TGIF2LX antibody - middle region; anti-TGIF2LX antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
Sequence Length
241
Applicable Applications for anti-TGIF2LX antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 93%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TGIF2LX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TGIF2LX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-TGIF2LX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-TGIF2LX antibody
This is a rabbit polyclonal antibody against TGIF2LX. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TGIF2LX is a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition.
Target Description: TGIF2LX is a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition.
Product Categories/Family for anti-TGIF2LX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
homeobox protein TGIF2LX
NCBI Official Synonym Full Names
TGFB induced factor homeobox 2 like X-linked
NCBI Official Symbol
TGIF2LX
NCBI Official Synonym Symbols
TGIFLX
NCBI Protein Information
homeobox protein TGIF2LX
UniProt Protein Name
Homeobox protein TGIF2LX
Protein Family
UniProt Gene Name
TGIF2LX
UniProt Synonym Gene Names
TGIFLX
UniProt Entry Name
TF2LX_HUMAN
NCBI Description
This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. [provided by RefSeq, Jul 2008]
Uniprot Description
TGIF2LX: May have a transcription role in testis. Belongs to the TALE/TGIF homeobox family.
Protein type: DNA-binding
Chromosomal Location of Human Ortholog: Xq21.31
Cellular Component: nucleus
Molecular Function: DNA binding
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Research Articles on TGIF2LX
Similar Products
Product Notes
The TGIF2LX tgif2lx (Catalog #AAA3202968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGIF2LX antibody - middle region reacts with Dog, Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGIF2LX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGIF2LX tgif2lx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVKVSVTSPS SPELVSPEEH ADFSSFLLLV DAAVQRAAEL ELEKKQEPNP. It is sometimes possible for the material contained within the vial of "TGIF2LX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
