Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- TGFBR1 Picoband antibody, MBS177675, Western blottingAll lanes: Anti TGFBR1 (MBS177675) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD)

anti-Human TGFBR1 Polyclonal Antibody | anti-TGFBR1 antibody

Anti-TGFBR1 Antibody

Gene Names
TGFBR1; AAT5; ALK5; ESS1; LDS1; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; ACVRLK4; tbetaR-I
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TGFBR1; Polyclonal Antibody; Anti-TGFBR1 Antibody; TGF-beta receptor type-1; AAT 5; AAT5; Activin A receptor type II like kinase 53kDa; Activin A receptor type II like kinase; 53kD; Activin A receptor type II like protein kinase of 53kD; activin A receptor type II-like kinase; 53kDa; activin A receptor type II-like protein kinase of 53kD; Activin receptor like kinase 5; Activin receptor-like kinase 5; ACVRLK 4; ACVRLK4; ALK 5; ALK-5; ALK5; LDS1A; LDS2A; MSSE; Serine/threonine protein kinase receptor R4; Serine/threonine-protein kinase receptor R4; SKR 4; SKR4; TbetaR I; TbetaR-I; TGF beta receptor type 1; TGF beta receptor type I; TGF beta type I receptor; TGF-beta receptor type I; TGF-beta type I receptor; TGFBR 1; TGFBR1 protein; TGFR 1; TGFR-1; TGFR1; TGFR1_HUMAN; Transforming growth factor beta receptor 1; Transforming growth factor beta receptor I (activin A receptor type II like kinase; 53kD); Transforming growth factor beta receptor I; transforming growth factor; beta receptor 1; beta receptor I (activin A receptor type II-like kinase; Transforming growth factor-beta receptor type I antibody; anti-TGFBR1 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
426
Applicable Applications for anti-TGFBR1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- TGFBR1 Picoband antibody, MBS177675, Western blottingAll lanes: Anti TGFBR1 (MBS177675) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD)

Western Blot (WB) (Anti- TGFBR1 Picoband antibody, MBS177675, Western blottingAll lanes: Anti TGFBR1 (MBS177675) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 55KDObserved bind size: 55KD)
Related Product Information for anti-TGFBR1 antibody
Description: Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.

Background: Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.
References
1. Drera, B., Tadini, G., Barlati, S., Colombi, M.Identification of a novel TGFBR1 mutation in a Loeys-Dietz syndrome type II patient with vascular Ehlers-Danlos syndrome phenotype. (Letter)Clin. Genet. 73: 290-293, 2008. 2. Goudie, D. R., D'Alessandro, M., Merriman, B., Lee, H., Szeverenyi, I., Avery, S., O'Connor, B. D., Nelson, S. F., Coats, S. E., Stewart, A., Christie, L., Pichert, G., and 11 others.Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1.Nature Genet. 43: 365-369, 2011. 3. Vellucci, V. F., Reiss, M.Cloning and genomic organization of the human transforming growth factor-beta type I receptor gene.Genomics 46: 278-283, 1997.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,690 Da
NCBI Official Full Name
TGF-beta receptor type-1 isoform 2
NCBI Official Synonym Full Names
transforming growth factor beta receptor 1
NCBI Official Symbol
TGFBR1
NCBI Official Synonym Symbols
AAT5; ALK5; ESS1; LDS1; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; ACVRLK4; tbetaR-I
NCBI Protein Information
TGF-beta receptor type-1
UniProt Protein Name
TGF-beta receptor type-1
Protein Family
UniProt Gene Name
TGFBR1
UniProt Synonym Gene Names
ALK5; SKR4; TGFR-1; ALK-5; ALK5; SKR4; TGF-beta receptor type I; TbetaR-I
UniProt Entry Name
TGFR1_HUMAN

NCBI Description

The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.

Research Articles on TGFBR1

Similar Products

Product Notes

The TGFBR1 tgfbr1 (Catalog #AAA177675) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TGFBR1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the TGFBR1 tgfbr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TGFBR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.