Immunohistochemistry (IHC)
(Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-TGFB1I1 antibody )
Rabbit TGFB1I1 Polyclonal Antibody | anti-TGFB1I1 antibody
TGFB1I1 antibody - N-terminal region
Gene Names
TGFB1I1; HIC5; ARA55; HIC-5; TSC-5
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TGFB1I1; Polyclonal Antibody; TGFB1I1 antibody - N-terminal region; anti-TGFB1I1 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS
Sequence Length
444
Applicable Applications for anti-TGFB1I1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TGFB1I1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-TGFB1I1 antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-TGFB1I1 antibody )
Western Blot (WB)
(WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-TGFB1I1 antibody
This is a rabbit polyclonal antibody against TGFB1I1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The TGFB1I1 gene encodes a protein that is a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.
Target Description: The TGFB1I1 gene encodes a protein that is a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.
Product Categories/Family for anti-TGFB1I1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kDa
NCBI Official Full Name
transforming growth factor beta-1-induced transcript 1 protein isoform 2
NCBI Official Synonym Full Names
transforming growth factor beta 1 induced transcript 1
NCBI Official Symbol
TGFB1I1
NCBI Official Synonym Symbols
HIC5; ARA55; HIC-5; TSC-5
NCBI Protein Information
transforming growth factor beta-1-induced transcript 1 protein
UniProt Protein Name
Transforming growth factor beta-1-induced transcript 1 protein
UniProt Gene Name
TGFB1I1
UniProt Synonym Gene Names
ARA55; Hic-5
UniProt Entry Name
TGFI1_HUMAN
NCBI Description
This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Research Articles on TGFB1I1
Similar Products
Product Notes
The TGFB1I1 tgfb1i1 (Catalog #AAA3204498) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFB1I1 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TGFB1I1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TGFB1I1 tgfb1i1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRSGAPKERP AEPLTPPPSY GHQPQTGSGE SSGASGDKDH LYSTVCKPRS. It is sometimes possible for the material contained within the vial of "TGFB1I1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
