Rabbit TGFB1I1 Polyclonal Antibody | anti-TGFB1I1 antibody

TGFB1I1 antibody - N-terminal region

Cat. Num. AAA3204498

• Gene Names: TGFB1I1; HIC5; ARA55; HIC-5; TSC-5
• Reactivity: Dog, Horse, Human, Mouse, Rabbit, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: TGFB1I1; Polyclonal Antibody; TGFB1I1 antibody - N-terminal region; anti-TGFB1I1 antibody

• Host: Rabbit
• Reactivity: Dog, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS
• Sequence Length: 444

• Applicable Applications for anti-TGFB1I1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Dog: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TGFB1I1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0ug/ml using anti-TGFB1I1 antibody )

Western Blot (WB)

(WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Related Product Information for anti-TGFB1I1 antibody

This is a rabbit polyclonal antibody against TGFB1I1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The TGFB1I1 gene encodes a protein that is a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.

Product Categories/Family for anti-TGFB1I1 antibody

Polyclonal; Transcription Factor; Transcription Regulation; Cell Adhesion; Transcription Regulation; Chromatin & Nuclear Signaling; Signal Transduction; Disease Related; Immunohistochemistry; Transcription Factors; Cell Differentiation

NCBI and Uniprot Product Information

• NCBI GI #: 21361591
• NCBI GeneID: 7041
• NCBI Accession #: NP_057011
• NCBI GenBank Nucleotide #: NM_015927
• UniProt Accession #: B2R8D5; O43294
• Molecular Weight: 48kDa
• NCBI Official Full Name: transforming growth factor beta-1-induced transcript 1 protein isoform 2
• NCBI Official Synonym Full Names: transforming growth factor beta 1 induced transcript 1
• NCBI Official Symbol: TGFB1I1
• NCBI Official Synonym Symbols: HIC5; ARA55; HIC-5; TSC-5
• NCBI Protein Information: transforming growth factor beta-1-induced transcript 1 protein
• UniProt Protein Name: Transforming growth factor beta-1-induced transcript 1 protein
• Protein Family: Transforming growth factor beta-1-induced transcript 1 protein
• UniProt Gene Name: TGFB1I1
• UniProt Synonym Gene Names: ARA55; Hic-5
• UniProt Entry Name: TGFI1_HUMAN

NCBI Description

This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]