Western Blot (WB)
(Host: RabbitTarget Name: TFIP11Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human TFIP11 Polyclonal Antibody | anti-TFIP11 antibody
TFIP11 Antibody - middle region
Gene Names
TFIP11; NTR1; STIP; TIP39; STIP-1; Spp382; bK445C9.6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TFIP11; Polyclonal Antibody; TFIP11 Antibody - middle region; anti-TFIP11 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SERTTQSMQDFPVVDSEEEAEEEFQKELSQWRKDPSGSKKKPKYSYKTVE
Sequence Length
837
Applicable Applications for anti-TFIP11 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TFIP11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TFIP11Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TFIP11Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TFIP11 antibody
TFIP11 is a nuclear speckle-localized protein that may play a role in spliceosome disassembly in Cajal bodies.
Product Categories/Family for anti-TFIP11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92 kDa
NCBI Official Full Name
tuftelin-interacting protein 11 isoform 1
NCBI Official Synonym Full Names
tuftelin interacting protein 11
NCBI Official Symbol
TFIP11
NCBI Official Synonym Symbols
NTR1; STIP; TIP39; STIP-1; Spp382; bK445C9.6
NCBI Protein Information
tuftelin-interacting protein 11
UniProt Protein Name
Tuftelin-interacting protein 11
Protein Family
UniProt Gene Name
TFIP11
UniProt Synonym Gene Names
STIP; HSPC006; STIP-1
UniProt Entry Name
TFP11_HUMAN
NCBI Description
This gene encodes a protein component of the spliceosome that promotes the release of the lariat-intron during late-stage splicing through the recruitment of a pre-mRNA splicing factor called DEAH-box helicase 15. The encoded protein contains a G-patch domain, a hallmark of RNA-processing proteins, that binds DEAH-box helicase 15. This protein contains an atypical nuclear localization sequence as well as a nuclear speckle-targeting sequence, enabling it to localize to distinct speckled regions within the cell nucleus. Polymorphisms in this gene are associated with dental caries suggesting a role in amelogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]
Research Articles on TFIP11
Similar Products
Product Notes
The TFIP11 tfip11 (Catalog #AAA3223344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFIP11 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFIP11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TFIP11 tfip11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SERTTQSMQD FPVVDSEEEA EEEFQKELSQ WRKDPSGSKK KPKYSYKTVE. It is sometimes possible for the material contained within the vial of "TFIP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
