Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)

Rabbit TFDP1 Polyclonal Antibody | anti-TFDP1 antibody

TFDP1 antibody - middle region

Gene Names
TFDP1; DP1; DILC; Dp-1; DRTF1
Reactivity
Cow, Human, Mouse, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TFDP1; Polyclonal Antibody; TFDP1 antibody - middle region; anti-TFDP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDE
Sequence Length
410
Applicable Applications for anti-TFDP1 antibody
Western Blot (WB)
Homology
Cow: 92%; Human: 100%; Mouse: 100%; Zebrafish: 84%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TFDP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)
Related Product Information for anti-TFDP1 antibody
This is a rabbit polyclonal antibody against TFDP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. The E2F transcription factor family (see MIM 189971) regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors; see TFDP2 (MIM 602160).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transcription factor Dp-1
NCBI Official Synonym Full Names
transcription factor Dp-1
NCBI Official Symbol
TFDP1
NCBI Official Synonym Symbols
DP1; DILC; Dp-1; DRTF1
NCBI Protein Information
transcription factor Dp-1
UniProt Protein Name
Transcription factor Dp-1
Protein Family
UniProt Gene Name
TFDP1
UniProt Synonym Gene Names
DP1; DRTF1
UniProt Entry Name
TFDP1_HUMAN

NCBI Description

This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X.[provided by RefSeq, Jan 2009]

Uniprot Description

TFDP1: Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F1/DP complex appears to mediate both cell proliferation and apoptosis. Belongs to the E2F/DP family.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: nucleoplasm; transcription factor complex

Molecular Function: protein domain specific binding; protein binding; DNA binding; transcription coactivator activity; transcription factor activity; transcription factor binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; epidermis development; transcription, DNA-dependent; apoptosis; anoikis; regulation of transcription from RNA polymerase II promoter; cell proliferation; transforming growth factor beta receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; gene expression; mitotic cell cycle; G1/S transition of mitotic cell cycle

Research Articles on TFDP1

Similar Products

Product Notes

The TFDP1 tfdp1 (Catalog #AAA3224644) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFDP1 antibody - middle region reacts with Cow, Human, Mouse, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TFDP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TFDP1 tfdp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSASDLTNGA DGMLATSSNG SQYSGSRVET PVSYVGEDDE EDDDFNENDE. It is sometimes possible for the material contained within the vial of "TFDP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.