Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TEX11Sample Type: 293T whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TEX11 Polyclonal Antibody | anti-TEX11 antibody

TEX11 Antibody - C-terminal region

Gene Names
TEX11; TGC1; TSGA3; SPGFX2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TEX11; Polyclonal Antibody; TEX11 Antibody - C-terminal region; anti-TEX11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAE
Sequence Length
615
Applicable Applications for anti-TEX11 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 92%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TEX11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TEX11Sample Type: 293T whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TEX11Sample Type: 293T whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TEX11 antibody
This is a rabbit polyclonal antibody against TEX11. It was validated on Western Blot

Target Description: This gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-TEX11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
testis-expressed protein 11 isoform 1
NCBI Official Synonym Full Names
testis expressed 11
NCBI Official Symbol
TEX11
NCBI Official Synonym Symbols
TGC1; TSGA3; SPGFX2
NCBI Protein Information
testis-expressed protein 11
UniProt Protein Name
Testis-expressed sequence 11 protein
UniProt Gene Name
TEX11
UniProt Entry Name
TEX11_HUMAN

NCBI Description

This gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TEX11: This gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Protein type: Unknown function

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: central element; synaptonemal complex

Molecular Function: protein binding

Biological Process: synaptonemal complex assembly; fertilization; meiotic recombination; male gonad development; male meiosis chromosome segregation; resolution of meiotic joint molecules as recombinants; meiotic gene conversion; chiasma formation; negative regulation of apoptosis

Disease: Spermatogenic Failure, X-linked, 2

Research Articles on TEX11

Similar Products

Product Notes

The TEX11 tex11 (Catalog #AAA3212599) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEX11 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's TEX11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TEX11 tex11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLAAQFALEN GQQIVAEKAL EYLAQHSEDQ EQVLTAVKCL LRFLLPKIAE. It is sometimes possible for the material contained within the vial of "TEX11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.