Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TESK2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit TESK2 Polyclonal Antibody | anti-TESK2 antibody

TESK2 Antibody - C-terminal region

Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TESK2; Polyclonal Antibody; TESK2 Antibody - C-terminal region; anti-TESK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFST
Sequence Length
555
Applicable Applications for anti-TESK2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 83%; Rabbit: 92%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TESK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TESK2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-TESK2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-TESK2 antibody
This is a rabbit polyclonal antibody against TESK2. It was validated on Western Blot

Target Description: This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
dual specificity testis-specific protein kinase 2 isoform 1
NCBI Official Synonym Full Names
testis associated actin remodelling kinase 2
NCBI Official Symbol
TESK2
NCBI Protein Information
dual specificity testis-specific protein kinase 2
UniProt Protein Name
Dual specificity testis-specific protein kinase 2
UniProt Gene Name
TESK2
UniProt Entry Name
TESK2_HUMAN

NCBI Description

This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

TESK2: a TKL kinase of the LISK family. Predominantly expressed in testis and prostate. The developmental expression pattern in the testis suggests an important role in meitoic stages and/or early stages of spermiogenesis. Three alternatively spliced isoforms have been described.

Protein type: Kinase, protein; EC 2.7.12.1; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; TKL group; LISK family; TESK subfamily

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; protein-tyrosine kinase activity; metal ion binding; protein serine/threonine/tyrosine kinase activity; ATP binding; protein kinase activity

Biological Process: focal adhesion formation; peptidyl-tyrosine phosphorylation; spermatogenesis; actin cytoskeleton organization and biogenesis; protein amino acid phosphorylation

Similar Products

Product Notes

The TESK2 tesk2 (Catalog #AAA3217208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TESK2 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TESK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TESK2 tesk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHEAMDCSIL QEENGFGSRP QGTSPCPAGA SEEMEVEERP AGSTPATFST. It is sometimes possible for the material contained within the vial of "TESK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.