Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TERF1 antibody Titration: 1 ug/mLSample Type: Human A549 Whole Cell)

Rabbit anti-Human TERF1 Polyclonal Antibody | anti-TERF1 antibody

TERF1 Antibody - C-terminal region

Gene Names
TERF1; TRF; PIN2; TRF1; TRBF1; t-TRF1; hTRF1-AS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TERF1; Polyclonal Antibody; TERF1 Antibody - C-terminal region; anti-TERF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKK
Sequence Length
439
Applicable Applications for anti-TERF1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TERF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TERF1 antibody Titration: 1 ug/mLSample Type: Human A549 Whole Cell)

Western Blot (WB) (WB Suggested Anti-TERF1 antibody Titration: 1 ug/mLSample Type: Human A549 Whole Cell)
Related Product Information for anti-TERF1 antibody
This is a rabbit polyclonal antibody against TERF1. It was validated on Western Blot

Target Description: This gene encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of individual chromosome ends. The protein structure contains a C-terminal Myb motif, a dimerization domain near its N-terminus and an acidic N-terminus. Two transcripts of this gene are alternatively spliced products.
Product Categories/Family for anti-TERF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
telomeric repeat-binding factor 1 isoform 1
NCBI Official Synonym Full Names
telomeric repeat binding factor 1
NCBI Official Symbol
TERF1
NCBI Official Synonym Symbols
TRF; PIN2; TRF1; TRBF1; t-TRF1; hTRF1-AS
NCBI Protein Information
telomeric repeat-binding factor 1
UniProt Protein Name
Telomeric repeat-binding factor 1
UniProt Gene Name
TERF1
UniProt Synonym Gene Names
PIN2; TRBF1; TRF; TRF1
UniProt Entry Name
TERF1_HUMAN

NCBI Description

This gene encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of individual chromosome ends. The protein structure contains a C-terminal Myb motif, a dimerization domain near its N-terminus and an acidic N-terminus. Two transcripts of this gene are alternatively spliced products. [provided by RefSeq, Jul 2008]

Uniprot Description

TRF1: a telomeric repeat binding factor. Binds the telomeric double-stranded TTAGGG repeat and negatively regulates telomere length. Colocalizes with telomeric DNA in interphase and metaphase cells and is located at chromosome ends during metaphase. Involved in the regulation of the mitotic spindle. Expression is tightly regulated during the cell cycle; levels are low in G1 and S phase and increase during G2 phase and mitosis. Two splice variant isoforms have been described.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: nucleoplasm; chromosome, telomeric region; nuclear telomere cap complex; nuclear chromosome, telomeric region; cytoplasm; nucleolus; spindle; nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; microtubule binding; telomeric DNA binding; double-stranded telomeric DNA binding; chromatin binding; DNA bending activity

Biological Process: response to drug; mitosis; positive regulation of mitosis; negative regulation of telomere maintenance via semi-conservative replication; positive regulation of apoptosis; positive regulation of microtubule polymerization; telomere maintenance via telomerase; positive regulation of mitotic cell cycle; negative regulation of telomerase activity; cell division; negative regulation of DNA replication; telomeric loop formation; mitotic cell cycle spindle assembly checkpoint; G2/M transition of mitotic cell cycle; age-dependent telomere shortening; telomere maintenance; negative regulation of telomere maintenance via telomerase; protein homooligomerization

Research Articles on TERF1

Similar Products

Product Notes

The TERF1 terf1 (Catalog #AAA3219940) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TERF1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TERF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TERF1 terf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSAVTESSEG TVSLLRSHKN LFLSKLQHGT QQQDLNKKER RVGTPQSTKK. It is sometimes possible for the material contained within the vial of "TERF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.