Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TEAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysate)

Rabbit TEAD2 Polyclonal Antibody | anti-TEAD2 antibody

TEAD2 antibody - middle region

Gene Names
TEAD2; ETF; TEF4; TEF-4; TEAD-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TEAD2; Polyclonal Antibody; TEAD2 antibody - middle region; anti-TEAD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVY
Sequence Length
447
Applicable Applications for anti-TEAD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TEAD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TEAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-TEAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysate)
Related Product Information for anti-TEAD2 antibody
This is a rabbit polyclonal antibody against TEAD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TEAD2 is a putative transcription factor that binds to the SPH and GT-IIC enhansons (5'-GTGGAATGT-3'). TEAD2 may be involved in the gene regulation of neural development. TEAD2 binds to the M-CAT motif.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
transcriptional enhancer factor TEF-4 isoform 3
NCBI Official Synonym Full Names
TEA domain transcription factor 2
NCBI Official Symbol
TEAD2
NCBI Official Synonym Symbols
ETF; TEF4; TEF-4; TEAD-2
NCBI Protein Information
transcriptional enhancer factor TEF-4
UniProt Protein Name
Transcriptional enhancer factor TEF-4
UniProt Gene Name
TEAD2
UniProt Synonym Gene Names
TEF4; TEAD-2
UniProt Entry Name
TEAD2_HUMAN

Uniprot Description

TEAD2: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds to the SPH and GT-IIC 'enhansons' (5'- GTGGAATGT-3'). May be involved in the gene regulation of neural development. Binds to the M-CAT motif. Interacts with YAP1 and WWTR1/TAZ.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; DNA binding; transcription factor activity

Biological Process: paraxial mesoderm development; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; neural tube closure; lateral mesoderm development; gene expression; positive regulation of transcription from RNA polymerase II promoter; vasculogenesis; notochord development

Research Articles on TEAD2

Similar Products

Product Notes

The TEAD2 tead2 (Catalog #AAA3200141) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEAD2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TEAD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TEAD2 tead2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGGFYGVSSQ YESLEHMTLT CSSKVCSFGK QVVEKVETER AQLEDGRFVY. It is sometimes possible for the material contained within the vial of "TEAD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.