Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TEAD1Sample Tissue: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit TEAD1 Polyclonal Antibody | anti-TEAD1 antibody

TEAD1 antibody - N-terminal region

Gene Names
TEAD1; AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1
Reactivity
Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TEAD1; Polyclonal Antibody; TEAD1 antibody - N-terminal region; anti-TEAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY
Sequence Length
411
Applicable Applications for anti-TEAD1 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TEAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TEAD1Sample Tissue: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TEAD1Sample Tissue: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TEAD1 Antibody Titration: 2.5ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-TEAD1 Antibody Titration: 2.5ug/mlPositive Control: Human Muscle)
Related Product Information for anti-TEAD1 antibody
This is a rabbit polyclonal antibody against TEAD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TEAD1 is a transcriptional enhancer. It interacts with a muscle-specific cofactor to promote skeletal muscle gene expression. The mutation in the TEAD1 gene is the cause of Sveinsson's chorioretinal atrophy
Product Categories/Family for anti-TEAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
transcriptional enhancer factor TEF-1
NCBI Official Synonym Full Names
TEA domain transcription factor 1
NCBI Official Symbol
TEAD1
NCBI Official Synonym Symbols
AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1
NCBI Protein Information
transcriptional enhancer factor TEF-1
UniProt Protein Name
Transcriptional enhancer factor TEF-1
UniProt Gene Name
TEAD1
UniProt Synonym Gene Names
TCF13; TEF1; TEAD-1; TCF-13
UniProt Entry Name
TEAD1_HUMAN

NCBI Description

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified. [provided by RefSeq, May 2010]

Uniprot Description

TEAD1: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and cooperatively to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription in vivo in a cell-specific manner. The activation function appears to be mediated by a limiting cell-specific transcriptional intermediary factor (TIF). Involved in cardiac development. Binds to the M-CAT motif. Interacts with YAP1 and WWTR1/TAZ. Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; gene expression

Disease: Sveinsson Chorioretinal Atrophy

Research Articles on TEAD1

Similar Products

Product Notes

The TEAD1 tead1 (Catalog #AAA3224652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEAD1 antibody - N-terminal region reacts with Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TEAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TEAD1 tead1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEPSSWSGSE SPAENMERMS DSADKPIDND AEGVWSPDIE QSFQEALAIY. It is sometimes possible for the material contained within the vial of "TEAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.