Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TCF3 monoclonal antibody, Western Blot analysis of TCF3 expression in HeLa NE.)

Rabbit anti-Human TCF7 Polyclonal Antibody | anti-TCF7 antibody

TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (PE)

Gene Names
TCF3; E2A; E47; ITF1; VDIR; TCF-3; bHLHb21
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TCF7; Polyclonal Antibody; TCF7 (Transcription Factor 7; T-cell Specific Transcription Factor 1; T-cell Factor 1; TCF-7; TCF-1; TCF1; MGC129647; MGC129648) (PE); anti-TCF7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TCF7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TCF7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TCF7, aa1-384 (NP_003193.2).
Immunogen Sequence
EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TCF3 monoclonal antibody, Western Blot analysis of TCF3 expression in HeLa NE.)

Western Blot (WB) (TCF3 monoclonal antibody, Western Blot analysis of TCF3 expression in HeLa NE.)

Testing Data

(Detection limit for recombinant GST tagged TCF3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TCF3 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-TCF7 antibody
The T cell specific transcription factor TCF7 activates genes involved in immune regulation and thymocyte differentiation, and is a candidate locus for genetic susceptibility to type 1 diabetes.
Product Categories/Family for anti-TCF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,510 Da
NCBI Official Full Name
transcription factor E2-alpha isoform E12
NCBI Official Synonym Full Names
transcription factor 3
NCBI Official Symbol
TCF3
NCBI Official Synonym Symbols
E2A; E47; ITF1; VDIR; TCF-3; bHLHb21
NCBI Protein Information
transcription factor E2-alpha; kappa-E2-binding factor; VDR interacting repressor; transcription factor ITF-1; helix-loop-helix protein HE47; transcription factor 3 variant 3; immunoglobulin transcription factor 1; vitamin D receptor-interacting repressor
UniProt Protein Name
Transcription factor E2-alpha
Protein Family
UniProt Gene Name
TCF3
UniProt Synonym Gene Names
BHLHB21; E2A; ITF1; bHLHb21; TCF-3
UniProt Entry Name
TFE2_HUMAN

NCBI Description

This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Sep 2011]

Uniprot Description

E2A: a transcription factor that plays major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Heterodimers between E2A and tissue-specific basic helix-loop-helix (bHLH) Dimers bind DNA on E-box motifs: 5'- CANNTG-3'. Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer. Deletions in E2A have been observed in a subset of pre-B-cell acute lymphoblastic leukemia (B-ALL) cases. Two alternatively spliced human isoforms have been described.

Protein type: Oncoprotein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; transcription factor complex; protein complex; cytoplasm; nuclear chromatin; nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; sequence-specific DNA binding; transcription coactivator activity; bHLH transcription factor binding; chromatin binding; mitogen-activated protein kinase kinase kinase binding; transcription factor binding; transcription factor activity

Biological Process: Peyer's patch development; response to drug; protein stabilization; transcription, DNA-dependent; immunoglobulin V(D)J recombination; positive regulation of transcription, DNA-dependent; B cell lineage commitment; T cell differentiation in the thymus; positive regulation of cell cycle; response to lipopolysaccharide; negative regulation of transcription from RNA polymerase II promoter; muscle cell differentiation; regulation of transcription, DNA-dependent; natural killer cell differentiation; B cell differentiation; positive regulation of B cell proliferation; positive regulation of muscle cell differentiation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of neuron differentiation; cell development

Research Articles on TCF7

Similar Products

Product Notes

The TCF7 tcf3 (Catalog #AAA6396224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCF7 tcf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.