Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TCF12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit TCF12 Polyclonal Antibody | anti-TCF12 antibody

TCF12 antibody - middle region

Gene Names
TCF12; HEB; p64; CRS3; HTF4; TCF-12; bHLHb20; HsT17266
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCF12; Polyclonal Antibody; TCF12 antibody - middle region; anti-TCF12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS
Sequence Length
682
Applicable Applications for anti-TCF12 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCF12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TCF12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-TCF12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-TCF12 antibody
This is a rabbit polyclonal antibody against TCF12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cell. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
transcription factor 12 isoform b
NCBI Official Synonym Full Names
transcription factor 12
NCBI Official Symbol
TCF12
NCBI Official Synonym Symbols
HEB; p64; CRS3; HTF4; TCF-12; bHLHb20; HsT17266
NCBI Protein Information
transcription factor 12
UniProt Protein Name
Transcription factor 12
Protein Family
UniProt Gene Name
TCF12
UniProt Synonym Gene Names
BHLHB20; HEB; HTF4; TCF-12; bHLHb20
UniProt Entry Name
HTF4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TCF12 iso3: Binds specifically to oligomers of E-box motifs. May play important roles during development of the nervous system as well as in other organ systems. Efficient DNA binding requires dimerization with another bHLH protein. Forms homo- or hetero-oligomers with myogenin, E12 and ITF2 proteins. Interacts with PTF1A.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: nuclear chromatin; cytoplasm; nucleus

Molecular Function: protein binding; protein heterodimerization activity; bHLH transcription factor binding; SMAD binding; transcription factor binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; muscle development; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of neuron differentiation

Research Articles on TCF12

Similar Products

Product Notes

The TCF12 tcf12 (Catalog #AAA3224588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF12 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCF12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCF12 tcf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGLQSQSGTV VTTEIKTENK EKDENLHEPP SSDDMKSDDE SSQKDIKVSS. It is sometimes possible for the material contained within the vial of "TCF12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.