Western Blot (WB)
(WB Suggested Anti-TCEAL2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit anti-Human TCEAL2 Polyclonal Antibody | anti-TCEAL2 antibody
TCEAL2 antibody - N-terminal region
Gene Names
TCEAL2; WEX1; my048; MY0876G05
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCEAL2; Polyclonal Antibody; TCEAL2 antibody - N-terminal region; anti-TCEAL2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENT
Sequence Length
227
Applicable Applications for anti-TCEAL2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCEAL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TCEAL2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TCEAL2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-TCEAL2 antibody
This is a rabbit polyclonal antibody against TCEAL2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TCEAL2 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.
Target Description: TCEAL2 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.
Product Categories/Family for anti-TCEAL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
transcription elongation factor A protein-like 2
NCBI Official Synonym Full Names
transcription elongation factor A like 2
NCBI Official Symbol
TCEAL2
NCBI Official Synonym Symbols
WEX1; my048; MY0876G05
NCBI Protein Information
transcription elongation factor A protein-like 2
UniProt Protein Name
Transcription elongation factor A protein-like 2
Protein Family
UniProt Gene Name
TCEAL2
UniProt Synonym Gene Names
TCEA-like protein 2
UniProt Entry Name
TCAL2_HUMAN
NCBI Description
This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. [provided by RefSeq, Jul 2008]
Uniprot Description
Function: May be involved in transcriptional regulation.
Subcellular location: Nucleus
Probable.
Sequence similarities: Belongs to the TFS-II family. TFA subfamily.
Research Articles on TCEAL2
Similar Products
Product Notes
The TCEAL2 tceal2 (Catalog #AAA3210077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCEAL2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCEAL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCEAL2 tceal2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEKLFNENEG MPSNQGKIDN EEQPPHEGKP EVACILEDKK LENEGNTENT. It is sometimes possible for the material contained within the vial of "TCEAL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
