Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TBXAS1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit anti-Human TBXAS1 Polyclonal Antibody | anti-TBXAS1 antibody

TBXAS1 Antibody - C-terminal region

Gene Names
TBXAS1; TS; TXS; CYP5; THAS; TXAS; CYP5A1; GHOSAL; BDPLT14
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBXAS1; Polyclonal Antibody; TBXAS1 Antibody - C-terminal region; anti-TBXAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV
Sequence Length
534
Applicable Applications for anti-TBXAS1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBXAS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TBXAS1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-TBXAS1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-TBXAS1 antibody
This is a rabbit polyclonal antibody against TBXAS1. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TBXAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
thromboxane-A synthase isoform 1
NCBI Official Synonym Full Names
thromboxane A synthase 1
NCBI Official Symbol
TBXAS1
NCBI Official Synonym Symbols
TS; TXS; CYP5; THAS; TXAS; CYP5A1; GHOSAL; BDPLT14
NCBI Protein Information
thromboxane-A synthase
UniProt Protein Name
Thromboxane-A synthase
Protein Family
UniProt Gene Name
TBXAS1
UniProt Synonym Gene Names
CYP5; CYP5A1; TXA synthase; TXS
UniProt Entry Name
THAS_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

TBXAS1: Defects in TBXAS1 are the cause of Ghosal hematodiaphyseal dysplasia (GHDD). GHDD is a rare autosomal recessive disorder characterized by increased bone density with predominant diaphyseal involvement and aregenerative corticosteroid-sensitive anemia. Aregenerative anemia is characterized by bone marrow failure, so that functional marrow cells are regenerated slowly or not at all. Defects in TBXAS1 are the cause of thromboxane synthetase deficiency (TBXAS1 deficiency). It is characterized by hemorrhagic diathesis. Belongs to the cytochrome P450 family.

Protein type: Lipid Metabolism - arachidonic acid; EC 5.3.99.5; Isomerase; Oxidoreductase; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q34-q35

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; iron ion binding; thromboxane-A synthase activity; heme binding; monooxygenase activity

Biological Process: xenobiotic metabolic process; cyclooxygenase pathway; icosanoid metabolic process; positive regulation of vasoconstriction; arachidonic acid metabolic process; cellular chloride ion homeostasis

Disease: Ghosal Hematodiaphyseal Dysplasia; Bleeding Disorder, Platelet-type, 14

Research Articles on TBXAS1

Similar Products

Product Notes

The TBXAS1 tbxas1 (Catalog #AAA3216714) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBXAS1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBXAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBXAS1 tbxas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDARHSASPM GVQDFDIVRD VFSSTGCKPN PSRQHQPSPM ARPLTVDEIV. It is sometimes possible for the material contained within the vial of "TBXAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.