Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TBX1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TBX1 Polyclonal Antibody | anti-TBX1 antibody

TBX1 Antibody - middle region

Gene Names
TBX1; DGS; TGA; VCF; CAFS; CTHM; DGCR; DORV; VCFS; TBX1C; CATCH22
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBX1; Polyclonal Antibody; TBX1 Antibody - middle region; anti-TBX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FAKGFRDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAE
Sequence Length
495
Applicable Applications for anti-TBX1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TBX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TBX1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TBX1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TBX1 antibody
This is a rabbit polyclonal antibody against TBX1. It was validated on Western Blot

Target Description: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product shares 98% amino acid sequence identity with the mouse ortholog. DiGeorge syndrome (DGS)/velocardiofacial syndrome (VCFS), a common congenital disorder characterized by neural-crest-related developmental defects, has been associated with deletions of chromosome 22q11.2, where this gene has been mapped. Studies using mouse models of DiGeorge syndrome suggest a major role for this gene in the molecular etiology of DGS/VCFS. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
T-box transcription factor TBX1 isoform X2
NCBI Official Synonym Full Names
T-box 1
NCBI Official Symbol
TBX1
NCBI Official Synonym Symbols
DGS; TGA; VCF; CAFS; CTHM; DGCR; DORV; VCFS; TBX1C; CATCH22
NCBI Protein Information
T-box transcription factor TBX1
UniProt Protein Name
T-box transcription factor TBX1
UniProt Gene Name
TBX1
UniProt Synonym Gene Names
T-box protein 1
UniProt Entry Name
TBX1_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product shares 98% amino acid sequence identity with the mouse ortholog. DiGeorge syndrome (DGS)/velocardiofacial syndrome (VCFS), a common congenital disorder characterized by neural-crest-related developmental defects, has been associated with deletions of chromosome 22q11.2, where this gene has been mapped. Studies using mouse models of DiGeorge syndrome suggest a major role for this gene in the molecular etiology of DGS/VCFS. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TBX1: Probable transcriptional regulator involved in developmental processes. Is required for normal development of the pharyngeal arch arteries. Haploinsufficiency of the TBX1 gene is responsible for most of the physical malformations present in DiGeorge syndrome (DGS) and velocardiofacial syndrome (VCFS). DGS is characterized by the association of several malformations: hypoplastic thymus and parathyroid glands, congenital conotruncal cardiopathy, and a subtle but characteristic facial dysmorphology. VCFS is marked by the association of congenital conotruncal heart defects, cleft palate or velar insufficiency, facial dysmorpholgy and learning difficulties. It is now accepted that these two syndromes represent two forms of clinical expression of the same entity manifesting at different stages of life. Defects in TBX1 are a cause of DiGeorge syndrome (DGS). Defects in TBX1 are a cause of velocardiofacial syndrome (VCFS). Defects in TBX1 are a cause of conotruncal heart malformations (CTHM). CTHM consist of cardiac outflow tract defects, such as tetralogy of Fallot, pulmonary atresia, double-outlet right ventricle, truncus arteriosus communis, and aortic arch anomalies. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: nucleus

Molecular Function: protein dimerization activity; protein homodimerization activity; DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: heart morphogenesis; retinoic acid receptor signaling pathway; muscle development; positive regulation of transcription, DNA-dependent; heart development; muscle cell fate commitment; cell fate specification; middle ear morphogenesis; ear morphogenesis; anterior/posterior pattern formation; sensory perception of sound; epithelial cell differentiation; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; thyroid gland development; mesoderm development; angiogenesis; muscle morphogenesis; neural crest cell migration; blood vessel development; inner ear morphogenesis; tongue morphogenesis; pharyngeal system development; thymus development; transcription, DNA-dependent; outer ear morphogenesis; semicircular canal morphogenesis; embryonic cranial skeleton morphogenesis; embryonic viscerocranium morphogenesis; social behavior; parathyroid gland development; pattern specification process; odontogenesis of dentine-containing teeth; regulation of transcription from RNA polymerase II promoter; cell proliferation; negative regulation of cell differentiation; blood vessel morphogenesis; artery morphogenesis; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; soft palate development; determination of left/right symmetry; lymph vessel development; vagus nerve morphogenesis; positive regulation of epithelial cell proliferation

Disease: Conotruncal Heart Malformations; Digeorge Syndrome; Velocardiofacial Syndrome; Tetralogy Of Fallot

Research Articles on TBX1

Similar Products

Product Notes

The TBX1 tbx1 (Catalog #AAA3219615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBX1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBX1 tbx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FAKGFRDCDP EDWPRNHRPG ALPLMSAFAR SRNPVASPTQ PSGTEKDAAE. It is sometimes possible for the material contained within the vial of "TBX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.