Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TBL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit TBL2 Polyclonal Antibody | anti-TBL2 antibody

TBL2 antibody - N-terminal region

Gene Names
TBL2; WBSCR13; WS-betaTRP
Reactivity
Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBL2; Polyclonal Antibody; TBL2 antibody - N-terminal region; anti-TBL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK
Sequence Length
447
Applicable Applications for anti-TBL2 antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TBL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TBL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-TBL2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-TBL2 antibody
This is a rabbit polyclonal antibody against TBL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
transducin beta-like protein 2 isoform 1
NCBI Official Synonym Full Names
transducin beta like 2
NCBI Official Symbol
TBL2
NCBI Official Synonym Symbols
WBSCR13; WS-betaTRP
NCBI Protein Information
transducin beta-like protein 2
UniProt Protein Name
Transducin beta-like protein 2
UniProt Gene Name
TBL2
UniProt Synonym Gene Names
WBSCR13; WS-betaTRP
UniProt Entry Name
TBL2_HUMAN

NCBI Description

This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008]

Uniprot Description

TBL2: TBL2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of TBL2 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: endoplasmic reticulum; integral to endoplasmic reticulum membrane

Molecular Function: translation initiation factor binding; phosphoprotein binding; protein kinase binding

Biological Process: cellular response to glucose starvation; unfolded protein response

Research Articles on TBL2

Similar Products

Product Notes

The TBL2 tbl2 (Catalog #AAA3211444) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBL2 antibody - N-terminal region reacts with Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TBL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBL2 tbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSGRPACQKA NGFPPDKSSG SKKQKQYQRI RKEKPQQHNF THRLLAAALK. It is sometimes possible for the material contained within the vial of "TBL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.