Mouse anti-Human TBCB Polyclonal Antibody | anti-TBCB antibody

TBCB (Tubulin-folding Cofactor B, Cytoskeleton-associated Protein 1, Cytoskeleton-associated Protein CKAPI, Tubulin-specific Chaperone B, CG22, CKAP1)

Cat. Num. AAA6002579

• Gene Names: TBCB; CG22; CKAP1; CKAPI
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TBCB; Polyclonal Antibody; TBCB (Tubulin-folding Cofactor B; Cytoskeleton-associated Protein 1; Cytoskeleton-associated Protein CKAPI; Tubulin-specific Chaperone B; CG22; CKAP1); Anti -TBCB (Tubulin-folding Cofactor B; anti-TBCB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TBCB.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

• Applicable Applications for anti-TBCB antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human TBCB, aa1-244 (AAH05969).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TBCB polyclonal antibody. Western Blot analysis of TBCB expression in HeLa.)

Western Blot (WB)

(TBCB polyclonal antibody. Western Blot analysis of TBCB expression in K-562.)

Western Blot (WB)

(Western Blot analysis of TBCB expression in transfected 293T cell line by TBCB polyclonal antibody. Lane 1: CKAP1 transfected lysate (26.84kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-TBCB antibody

Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.

Product Categories/Family for anti-TBCB antibody

Antibodies; Abs to Tubulin

NCBI and Uniprot Product Information

• NCBI GI #: 50428925
• NCBI GeneID: 1155
• NCBI Accession #: NP_001272.2
• NCBI GenBank Nucleotide #: NM_001281.2
• UniProt Accession #: Q99426; O00111; O00674; O14728
• Molecular Weight: 27,326 Da
• NCBI Official Full Name: tubulin-folding cofactor B
• NCBI Official Synonym Full Names: tubulin folding cofactor B
• NCBI Official Symbol: TBCB
• NCBI Official Synonym Symbols: CG22; CKAP1; CKAPI
• NCBI Protein Information: tubulin-folding cofactor B; tubulin-specific chaperone B; cytoskeleton associated protein 1; cytoskeleton-associated protein 1; cytoskeleton-associated protein CKAPI
• UniProt Protein Name: Tubulin-folding cofactor B
• UniProt Gene Name: TBCB
• UniProt Synonym Gene Names: CG22; CKAP1
• UniProt Entry Name: TBCB_HUMAN

Uniprot Description

TBCB: a cytoskeletal protein that binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal; Chaperone

Chromosomal Location of Human Ortholog: 19q13.11-q13.12

Cellular Component: microtubule cytoskeleton; nucleoplasm; microtubule; cytoplasm

Molecular Function: protein binding

Biological Process: 'de novo' posttranslational protein folding; nervous system development; cellular protein metabolic process; cell differentiation