Western Blot (WB)
(Host: RabbitTarget Name: TBC1D22ASample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human TBC1D22A Polyclonal Antibody | anti-TBC1D22A antibody
TBC1D22A Antibody - N-terminal region
Gene Names
TBC1D22A; C22orf4; HSC79E021
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TBC1D22A; Polyclonal Antibody; TBC1D22A Antibody - N-terminal region; anti-TBC1D22A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRP
Sequence Length
517
Applicable Applications for anti-TBC1D22A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of Human TBC1D22A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TBC1D22ASample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TBC1D22ASample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TBC1D22A antibody
May act as a GTPase-activating protein for Rab family protein(s).
Product Categories/Family for anti-TBC1D22A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
TBC1 domain family member 22A isoform b
NCBI Official Synonym Full Names
TBC1 domain family member 22A
NCBI Official Symbol
TBC1D22A
NCBI Official Synonym Symbols
C22orf4; HSC79E021
NCBI Protein Information
TBC1 domain family member 22A
UniProt Protein Name
TBC1 domain family member 22A
Protein Family
UniProt Gene Name
TBC1D22A
UniProt Synonym Gene Names
C22orf4
UniProt Entry Name
TB22A_HUMAN
Research Articles on TBC1D22A
Similar Products
Product Notes
The TBC1D22A tbc1d22a (Catalog #AAA3222876) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBC1D22A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBC1D22A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBC1D22A tbc1d22a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFESNTSDAW DAGEDDDELL AMAAESLNSE VVMETANRVL RNHSQRQGRP. It is sometimes possible for the material contained within the vial of "TBC1D22A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
