Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit TBC1D16 Polyclonal Antibody | anti-TBC1D16 antibody

TBC1D16 antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
TBC1D16; Polyclonal Antibody; TBC1D16 antibody; Polyclonal TBC1D16; Anti-TBC1D16; TBC 1; TBC-1; TBC1; Tbc1 Domain Family Member 16; MGC25062; FLJ20748; anti-TBC1D16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
TBC1D16 antibody was raised against the N terminal of TBC1D16
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TBC1D16 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
278
Applicable Applications for anti-TBC1D16 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TBC1D16 may act as a GTPase-activating protein for Rab family proteins.
Cross-Reactivity
Human
Immunogen
TBC1D16 antibody was raised using the N terminal of TBC1D16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-TBC1D16 antibody
Rabbit polyclonal TBC1D16 antibody raised against the N terminal of TBC1D16
Product Categories/Family for anti-TBC1D16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86 kDa (MW of target protein)
NCBI Official Full Name
TBC1 domain family member 16 isoform d
NCBI Official Synonym Full Names
TBC1 domain family, member 16
NCBI Official Symbol
TBC1D16
NCBI Protein Information
TBC1 domain family member 16
UniProt Protein Name
TBC1 domain family member 16
Protein Family
UniProt Gene Name
TBC1D16
UniProt Entry Name
TBC16_HUMAN

Uniprot Description

TBC1D16: a putative GTPase activating protein for Rab family protein(s).

Protein type: GAPs, Rab; GAPs

Chromosomal Location of Human Ortholog: 17q25.3

Molecular Function: protein binding

Research Articles on TBC1D16

Similar Products

Product Notes

The TBC1D16 tbc1d16 (Catalog #AAA5300951) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TBC1D16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TBC1D16 tbc1d16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBC1D16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.