Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAS1R1Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TAS1R1 Polyclonal Antibody | anti-TAS1R1 antibody

TAS1R1 Antibody - middle region

Gene Names
TAS1R1; TR1; T1R1; GM148; GPR70
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAS1R1; Polyclonal Antibody; TAS1R1 Antibody - middle region; anti-TAS1R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP
Sequence Length
841
Applicable Applications for anti-TAS1R1 antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TAS1R1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAS1R1Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAS1R1Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TAS1R1 antibody
This is a rabbit polyclonal antibody against TAS1R1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TAS1R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
taste receptor type 1 member 1 isoform b
NCBI Official Synonym Full Names
taste 1 receptor member 1
NCBI Official Symbol
TAS1R1
NCBI Official Synonym Symbols
TR1; T1R1; GM148; GPR70
NCBI Protein Information
taste receptor type 1 member 1
UniProt Protein Name
Taste receptor type 1 member 1
Protein Family
UniProt Gene Name
TAS1R1
UniProt Synonym Gene Names
GPR70; T1R1; TR1
UniProt Entry Name
TS1R1_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

TAS1R1: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate). Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses. Belongs to the G-protein coupled receptor 3 family. TAS1R subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 3; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 1p36.23

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein heterodimerization activity; taste receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; sensory perception of umami taste; detection of chemical stimulus involved in sensory perception of taste

Research Articles on TAS1R1

Similar Products

Product Notes

The TAS1R1 tas1r1 (Catalog #AAA3216884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAS1R1 Antibody - middle region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAS1R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAS1R1 tas1r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKRAVPGLKA FEEAYARADK KAPRPCHKGS WCSSNQLCRE CQAFMAHTMP. It is sometimes possible for the material contained within the vial of "TAS1R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.