Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TAOK2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Rabbit anti-Human TAOK2 Polyclonal Antibody | anti-TAOK2 antibody

TAOK2 Rabbit pAb

Gene Names
TAOK2; PSK; PSK1; TAO1; TAO2; MAP3K17; PSK1-BETA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
TAOK2; Polyclonal Antibody; TAOK2 Rabbit pAb; MAP3K17; PSK; PSK1; PSK1-BETA; TAO1; TAO2; anti-TAOK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
Applicable Applications for anti-TAOK2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2).
Positive Samples
MCF7, 293T
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TAOK2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TAOK2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-TAOK2 antibody
Background: This gene encodes a serine/threonine protein kinase that is involved in many different processes, including, cell signaling, microtubule organization and stability, and apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
1235
NCBI Official Full Name
Serine/threonine-protein kinase TAO2
NCBI Official Synonym Full Names
TAO kinase 2
NCBI Official Symbol
TAOK2
NCBI Official Synonym Symbols
PSK; PSK1; TAO1; TAO2; MAP3K17; PSK1-BETA
NCBI Protein Information
serine/threonine-protein kinase TAO2; PSK-1; hKFC-C; kinase from chicken homolog C; prostate-derived STE20-like kinase 1; prostate derived STE20-like kinase PSK; prostate-derived sterile 20-like kinase 1; thousand and one amino acid protein kinase 2
UniProt Protein Name
Serine/threonine-protein kinase TAO2
UniProt Gene Name
TAOK2
UniProt Synonym Gene Names
KIAA0881; MAP3K17; PSK; PSK1; hKFC-C; PSK-1; PSK1; Prostate-derived STE20-like kinase 1
UniProt Entry Name
TAOK2_HUMAN

NCBI Description

This gene encodes a serine/threonine protein kinase that is involved in many different processes, including, cell signaling, microtubule organization and stability, and apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

TAO2: a serine/threonine-protein kinase of the STE20 family. Activates the p38 MAPK signaling pathway through the specific activation of the upstream kinases MKK3 and MKK6. A potential multi-pass membrane protein. Activated in the DNA damage response and regulates the G2/M transition DNA damage checkpoint. Interacts with tubulins through the C-terminal domain. Involved in apoptotic processes such as membrane blebbing and apoptotic body formation. Prevents TAK1-mediated activation of IKK-alpha, and thus NF-kappa-B activation. May play a role in the osmotic stress-JNK1 pathway. An autism spectrum disorder susceptibility gene. Affects basal dendrite formation and axonal projections in cortical pyramidal neurons. Interacts with NRP1 (neuropilin 1), a receptor for the secreted guidance protein semaphorin 3A (Sema3A). Influences the formation of basal dendrites through the activation of JNK. Three isoforms of the human protein are produced by alternative splicing. Isoform 2, but not isoform 1, is required for PCDH8 endocytosis. Isoform 2 and kinase-defective, as well as full-length isoform 1 are excluded from the nucleus. Catalytically active full-length phosphorylated isoform 1 localizes to microtubules in the cytoplasm predominantly on microtubule cables positioned around the nucleus. A C-terminally truncated form of isoform 1 is present in the nucleus.

Protein type: Kinase, protein; Membrane protein, integral; Apoptosis; Protein kinase, STE; Membrane protein, multi-pass; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family; TAO subfamily

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytoplasmic vesicle membrane; cytoskeleton; cytoplasmic membrane-bound vesicle; dendrite; cytoplasm; nucleolus; integral to membrane; nucleus; receptor complex

Molecular Function: protein serine/threonine kinase activity; MAP kinase kinase kinase activity; mitogen-activated protein kinase kinase binding; ATP binding

Biological Process: focal adhesion formation; cell migration; activation of MAPKK activity; apoptosis; stress-activated MAPK cascade; positive regulation of JNK cascade; protein amino acid phosphorylation; positive regulation of stress-activated MAPK cascade; regulation of cell shape; response to stress; regulation of cell growth; G2/M transition DNA damage checkpoint; actin cytoskeleton organization and biogenesis; protein targeting to membrane; response to DNA damage stimulus

Research Articles on TAOK2

Similar Products

Product Notes

The TAOK2 taok2 (Catalog #AAA9142593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAOK2 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAOK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TAOK2 taok2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AEWLLRQKEQ LQQCQAEEEA GLLRRQRQYF ELQCRQYKRK MLLARHSLDQ DLLREDLNKK QTQKDLECAL LLRQHEATRE LELRQLQAVQ RTRAELTRLQ HQTELGNQLE YNKRREQELR Q. It is sometimes possible for the material contained within the vial of "TAOK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.