Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TANK rabbit polyclonal antibody. Western Blot analysis of TANK expression in human liver.)

Rabbit anti-Human TANK Polyclonal Antibody | anti-TANK antibody

TANK (TRAF Family Member-associated NF-kappa-B Activator, TRAF-interacting Protein, ITRAF, I-TRAF, TRAF2) (HRP)

Gene Names
TANK; ITRAF; TRAF2; I-TRAF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TANK; Polyclonal Antibody; TANK (TRAF Family Member-associated NF-kappa-B Activator; TRAF-interacting Protein; ITRAF; I-TRAF; TRAF2) (HRP); anti-TANK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TANK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
698
Applicable Applications for anti-TANK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TANK, aa1-119 (NP_597841.1).
Immunogen Sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TANK rabbit polyclonal antibody. Western Blot analysis of TANK expression in human liver.)

Western Blot (WB) (TANK rabbit polyclonal antibody. Western Blot analysis of TANK expression in human liver.)

Western Blot (WB)

(Western Blot analysis of TANK expression in transfected 293T cell line by TANK polyclonal antibody. Lane 1: TANK transfected lysate (13.6kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of TANK expression in transfected 293T cell line by TANK polyclonal antibody. Lane 1: TANK transfected lysate (13.6kD). Lane 2: Non-transfected lysate. )
Product Categories/Family for anti-TANK antibody
References
1. Cheng, G., et al., (1996), "TANK, a co-inducer with TRAF2 of TNF-and CD40L-mediated NF-kappaB activation", Genes Dev., 10: 963-973. 2. Rothe, M., et al., (1996), "I-TRAF is a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction", Proc. Natl. Acad. Sci. USA, 93: 8241-8246. 3. Pomerantz, J.L., et al., (1999), "NF-kappaB activation by a signaling complex containing TRAF2, TANK and TBK1, a novel IKK-related kinase", EMBO J., 18: 6694-6704. 4. Chariot, A., et al., (2002), "Association of the adaptor TANK with the I kappaB kinase (IKK) regulator NEMO connects IKK complexes with the IKK epsilon and TBK1 kinases", J. Biol. Chem., 277: 37029-37036.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens TRAF family member associated NFKB activator (TANK), transcript variant 2, mRNA
NCBI Official Synonym Full Names
TRAF family member associated NFKB activator
NCBI Official Symbol
TANK
NCBI Official Synonym Symbols
ITRAF; TRAF2; I-TRAF
NCBI Protein Information
TRAF family member-associated NF-kappa-B activator
UniProt Protein Name
TRAF family member-associated NF-kappa-B activator
Protein Family
UniProt Gene Name
TANK
UniProt Synonym Gene Names
ITRAF; TRAF2; I-TRAF
UniProt Entry Name
TANK_HUMAN

NCBI Description

The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

TANK: Acts as a regulator of TRAF function by maintaining them in a latent state. Overexpression inhibits TRAF2-mediated NF- kappa-B activation signaled by CD40, TNFR1 and TNFR2. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. May be involved in I-kappa-B-kinase (IKK) regulation; may function as an adapter for kinases such as TBK1 or IKBKE that can modulate IKK activity. Interacts with TBK1 (via TRAF-C domain). Interacts with TRAF1 (via TRAF-C domain). Interacts with TRAF2 (via TRAF-C domain); the interaction is disrupted by the phosphorylation of TANK by IKBKE. Interacts with TRAF3 (via TRAF-C domain); the interaction with TRAF3 is weaker than the interactions with TRAF1 and TRAF3. Interacts with IKBKG; the interaction is enhanced by IKBKE and TBK1. Part of a ternary complex consisting of TANK, IKBKB and IKBKG. Ubiquitous. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 2q24.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; metal ion binding; ubiquitin protein ligase binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; MyD88-independent toll-like receptor signaling pathway; toll-like receptor signaling pathway; innate immune response; toll-like receptor 3 signaling pathway; signal transduction; toll-like receptor 4 signaling pathway

Research Articles on TANK

Similar Products

Product Notes

The TANK tank (Catalog #AAA6395998) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TANK (TRAF Family Member-associated NF-kappa-B Activator, TRAF-interacting Protein, ITRAF, I-TRAF, TRAF2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TANK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TANK tank for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TANK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.