Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TALDO1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Mouse TALDO1 Polyclonal Antibody | anti-TALDO1 antibody

TALDO1 Antibody - middle region

Gene Names
TALDO1; TAL; TALH; TAL-H; TALDOR
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TALDO1; Polyclonal Antibody; TALDO1 Antibody - middle region; anti-TALDO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKK
Sequence Length
337
Applicable Applications for anti-TALDO1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse TALDO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TALDO1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TALDO1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TALDO1 antibody
Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydryl groups and cellular integrity from oxygen radicals. The functional gene of transaldolase 1 is located on chromosome 11 and a pseudogene is identified on chromosome 1 but there are conflicting map locations. The second and third exon of this gene were developed by insertion of a retrotransposable element. This gene is thought to be involved in multiple sclerosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
transaldolase
NCBI Official Synonym Full Names
transaldolase 1
NCBI Official Symbol
TALDO1
NCBI Official Synonym Symbols
TAL; TALH; TAL-H; TALDOR
NCBI Protein Information
transaldolase
UniProt Protein Name
Transaldolase
Protein Family
UniProt Gene Name
Taldo1
UniProt Synonym Gene Names
Tal; Taldo
UniProt Entry Name
TALDO_MOUSE

NCBI Description

Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydryl groups and cellular integrity from oxygen radicals. The functional gene of transaldolase 1 is located on chromosome 11 and a pseudogene is identified on chromosome 1 but there are conflicting map locations. The second and third exon of this gene were developed by insertion of a retrotransposable element. This gene is thought to be involved in multiple sclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

TALDO1: Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway. Defects in TALDO1 are the cause of transaldolase 1 deficiency (TALDO1 deficiency). It results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris. Belongs to the transaldolase family. Type 1 subfamily.

Protein type: Carbohydrate Metabolism - pentose phosphate pathway; EC 2.2.1.2; Transferase

Cellular Component: cytoplasm; cytosol; intracellular membrane-bound organelle; nucleus

Molecular Function: carbohydrate binding; catalytic activity; monosaccharide binding; transaldolase activity; transferase activity

Biological Process: carbohydrate metabolic process; fructose 6-phosphate metabolic process; glyceraldehyde-3-phosphate metabolic process; pentose-phosphate shunt; pentose-phosphate shunt, non-oxidative branch

Research Articles on TALDO1

Similar Products

Product Notes

The TALDO1 taldo1 (Catalog #AAA3220425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TALDO1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TALDO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TALDO1 taldo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACAEAGVTLI SPFVGRILDW HVANTDKKSY EPLEDPGVKS VTKIYNYYKK. It is sometimes possible for the material contained within the vial of "TALDO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.