Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TAGAP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit TAGAP Polyclonal Antibody | anti-TAGAP antibody

TAGAP antibody - N-terminal region

Gene Names
TAGAP; FKSG15; IDDM21; TAGAP1; ARHGAP47
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAGAP; Polyclonal Antibody; TAGAP antibody - N-terminal region; anti-TAGAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLS
Sequence Length
731
Applicable Applications for anti-TAGAP antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TAGAP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Western Blot (WB) (WB Suggested Anti-TAGAP AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-TAGAP antibody
This is a rabbit polyclonal antibody against TAGAP. It was validated on Western Blot

Target Description: This gene encodes a protein that may function as a Rho GTPase-activating protein. Transcript variants encoding distinct isoforms have been identified.
Product Categories/Family for anti-TAGAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
T-cell activation Rho GTPase-activating protein isoform b
NCBI Official Synonym Full Names
T cell activation RhoGTPase activating protein
NCBI Official Symbol
TAGAP
NCBI Official Synonym Symbols
FKSG15; IDDM21; TAGAP1; ARHGAP47
NCBI Protein Information
T-cell activation Rho GTPase-activating protein
UniProt Protein Name
T-cell activation Rho GTPase-activating protein
UniProt Gene Name
TAGAP
UniProt Synonym Gene Names
TAGAP1
UniProt Entry Name
TAGAP_HUMAN

NCBI Description

This gene encodes a member of the Rho GTPase-activator protein superfamily. The encoded protein may function as a Rho GTPase-activating protein. Alterations in this gene may be associated with several diseases, including rheumatoid arthritis, celiac disease, and multiple sclerosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

TAGAP: an apparent GTPase-activating protein (GAP) for Rho monomeric G proteins. May play important roles during T-cell activation. Mutations have been associated with various autoimmune conditions including rheumatoid arthritis, Crohn¿s disease, and celiac disease. Four isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: cytosol

Molecular Function: guanyl-nucleotide exchange factor activity

Biological Process: regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; positive regulation of GTPase activity

Research Articles on TAGAP

Similar Products

Product Notes

The TAGAP tagap (Catalog #AAA3215502) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAGAP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAGAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAGAP tagap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRPNLLLLKH LVYVLHLISK NSEVNRMDSS NLAICIGPNM LTLENDQSLS. It is sometimes possible for the material contained within the vial of "TAGAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.