Rabbit anti-Human TAF9B Polyclonal Antibody | anti-TAF9B antibody

TAF9B (Transcription Initiation Factor TFIID Subunit 9B, Neuronal Cell Death-related Protein 7, DN7, DN-7, Transcription Initiation Factor TFIID Subunit 9-like, TAF9L, Transcription-associated Factor TAFII31L, TFIID-31) (AP)

Cat. Num. AAA6395972

• Gene Names: TAF9B; DN7; DN-7; TAF9L; TAFII31L; TFIID-31
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF9B; Polyclonal Antibody; TAF9B (Transcription Initiation Factor TFIID Subunit 9B; Neuronal Cell Death-related Protein 7; DN7; DN-7; Transcription Initiation Factor TFIID Subunit 9-like; TAF9L; Transcription-associated Factor TAFII31L; TFIID-31) (AP); anti-TAF9B antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TAF9B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TAF9B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TAF9B, aa1-450, (NP_057059.2, 51616).
• Immunogen Sequence: MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF9B expression in transfected 293T cell line by TAF9B polyclonal antibody. Lane 1: TAF9B transfected lysate (27.6kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TAF9B antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 85062626
• NCBI GeneID: 51616
• NCBI Accession #: NP_057059.2
• NCBI GenBank Nucleotide #: NM_015975.4
• Molecular Weight: 27,622 Da
• NCBI Official Full Name: Homo sapiens TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa (TAF9B), mRNA
• NCBI Official Synonym Full Names: TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
• NCBI Official Symbol: TAF9B
• NCBI Official Synonym Symbols: DN7; DN-7; TAF9L; TAFII31L; TFIID-31
• NCBI Protein Information: transcription initiation factor TFIID subunit 9B; TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa; TBP-associated factor 9L; neuronal cell death-related protein 7; transcription associated factor TAFII31L; transcriptio
• Protein Family: Transcription initiation factor

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process. [provided by RefSeq, Jul 2008]