Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TAF9B expression in transfected 293T cell line by TAF9B polyclonal antibody. Lane 1: TAF9B transfected lysate (27.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TAF9B Polyclonal Antibody | anti-TAF9B antibody

TAF9B (Transcription Initiation Factor TFIID Subunit 9B, Neuronal Cell Death-related Protein 7, DN7, DN-7, Transcription Initiation Factor TFIID Subunit 9-like, TAF9L, Transcription-associated Factor TAFII31L, TFIID-31) (AP)

Gene Names
TAF9B; DN7; DN-7; TAF9L; TAFII31L; TFIID-31
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF9B; Polyclonal Antibody; TAF9B (Transcription Initiation Factor TFIID Subunit 9B; Neuronal Cell Death-related Protein 7; DN7; DN-7; Transcription Initiation Factor TFIID Subunit 9-like; TAF9L; Transcription-associated Factor TAFII31L; TFIID-31) (AP); anti-TAF9B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TAF9B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TAF9B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TAF9B, aa1-450, (NP_057059.2, 51616).
Immunogen Sequence
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF9B expression in transfected 293T cell line by TAF9B polyclonal antibody. Lane 1: TAF9B transfected lysate (27.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TAF9B expression in transfected 293T cell line by TAF9B polyclonal antibody. Lane 1: TAF9B transfected lysate (27.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TAF9B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,622 Da
NCBI Official Full Name
Homo sapiens TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa (TAF9B), mRNA
NCBI Official Synonym Full Names
TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
NCBI Official Symbol
TAF9B
NCBI Official Synonym Symbols
DN7; DN-7; TAF9L; TAFII31L; TFIID-31
NCBI Protein Information
transcription initiation factor TFIID subunit 9B; TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa; TBP-associated factor 9L; neuronal cell death-related protein 7; transcription associated factor TAFII31L; transcriptio

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process. [provided by RefSeq, Jul 2008]

Research Articles on TAF9B

Similar Products

Product Notes

The TAF9B (Catalog #AAA6395972) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF9B (Transcription Initiation Factor TFIID Subunit 9B, Neuronal Cell Death-related Protein 7, DN7, DN-7, Transcription Initiation Factor TFIID Subunit 9-like, TAF9L, Transcription-associated Factor TAFII31L, TFIID-31) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF9B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF9B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF9B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.