Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TBN transfected lysate (19.14kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TAF8 Polyclonal Antibody | anti-TAF8 antibody

TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43 kDa, Transcription Initiation Factor TFIID 43 kDa Subunit, TAFII-43, TAFII43, hTAFII43)

Gene Names
TAF8; 43; II; TAF; TBN; TAFII43; TAFII-43
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TAF8; Polyclonal Antibody; TAF8 (Transcription Initiation Factor TFIID Subunit 8; TBP-associated Factor 8; Protein Taube Nuss; TBN; TBP-associated Factor 43 kDa; Transcription Initiation Factor TFIID 43 kDa Subunit; TAFII-43; TAFII43; hTAFII43); Anti -TAF8 (Transcription Initiation Factor TFIID Subunit 8; anti-TAF8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TBN.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Applicable Applications for anti-TAF8 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human TBN, aa1-174 (AAH33728.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TBN transfected lysate (19.14kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TBN transfected lysate (19.14kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to TAF8 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to TAF8 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-TAF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,262 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 8
NCBI Official Synonym Full Names
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
NCBI Official Symbol
TAF8
NCBI Official Synonym Symbols
43; II; TAF; TBN; TAFII43; TAFII-43
NCBI Protein Information
transcription initiation factor TFIID subunit 8; hTAFII43; protein taube nuss; taube nuss homolog; TBP-associated factor 8; TBP-associated factor 43 kDa; TBP-associated factor TAFII43; TBP-associated factor, RNA polymerase II, 43 kD; transcription initiation factor TFIID 43 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50kDa
UniProt Protein Name
Transcription initiation factor TFIID subunit 8
UniProt Gene Name
TAF8
UniProt Synonym Gene Names
TAFII43; TBN; TAFII-43; TAFII43; hTAFII43
UniProt Entry Name
TAF8_HUMAN

NCBI Description

This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TBN: Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. Mediates both basal and activator-dependent transcription. Plays a role in the differentiation of preadipocyte fibroblasts to adipocytes, however, does not seem to play a role in differentiation of myoblasts. Required for the integration of TAF10 in the TAF complex. May be important for survival of cells of the inner cell mass which constitute the pluripotent cell population of the early embryo. Belongs to the TAF8 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nucleoplasm; transcription factor TFIID complex; perinuclear region of cytoplasm; nucleus

Molecular Function: protein binding; protein heterodimerization activity

Biological Process: transcription, DNA-dependent; regulation of fat cell differentiation; positive regulation of transcription, DNA-dependent; maintenance of protein localization in nucleus; cell differentiation; inner cell mass cell proliferation

Research Articles on TAF8

Similar Products

Product Notes

The TAF8 taf8 (Catalog #AAA6011204) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43 kDa, Transcription Initiation Factor TFIID 43 kDa Subunit, TAFII-43, TAFII43, hTAFII43) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the TAF8 taf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADAAATAGA GGSGTRSGSK QSTNPADNYH LARRRTLQVV VSSLLTEAGF ESAEKASVET LTEMLQSYIS EIGRSAKSYC EHTARTQPTL SDIVVTLVEM GFNVDTLPAY AKRSQRMVIT APPVTNQPVT PKALTAGQNR PHPPHIPSHF PEFPDPHTYI KTPVSDEALG LRVV. It is sometimes possible for the material contained within the vial of "TAF8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.