Western Blot (WB)
(Western Blot analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TAF8 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human TAF8 Polyclonal Antibody | anti-TAF8 antibody
TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (AP)
Gene Names
TAF8; II; TAF; TBN; TAFII43; TAFII-43
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF8; Polyclonal Antibody; TAF8 (Transcription Initiation Factor TFIID Subunit 8; TBP-associated Factor 8; Protein Taube Nuss; TBN; TBP-associated Factor 43kD; Transcription Initiation Factor TFIID 43kD Subunit; TAFII-43; TAFII43; hTAFII43) (AP); 43; II; TAF; anti-TAF8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TAF8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TAF8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TAF8, aa1-174 (AAH33728.1).
Immunogen Sequence
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TAF8 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TAF8 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TAF8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
37,411 Da
NCBI Official Full Name
Homo sapiens TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa, mRNA
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 8
NCBI Official Symbol
TAF8
NCBI Official Synonym Symbols
II; TAF; TBN; TAFII43; TAFII-43
NCBI Protein Information
transcription initiation factor TFIID subunit 8
Protein Family
NCBI Description
This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Research Articles on TAF8
Similar Products
Product Notes
The TAF8 (Catalog #AAA6395961) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43kD, Transcription Initiation Factor TFIID 43kD Subunit, TAFII-43, TAFII43, hTAFII43) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
