Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TACC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)

Rabbit TACC3 Polyclonal Antibody | anti-TACC3 antibody

TACC3 antibody - middle region

Gene Names
TACC3; ERIC1; ERIC-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TACC3; Polyclonal Antibody; TACC3 antibody - middle region; anti-TACC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES
Sequence Length
838
Applicable Applications for anti-TACC3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TACC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TACC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-TACC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-TACC3 antibody
This is a rabbit polyclonal antibody against TACC3. It was validated on Western Blot

Target Description: The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.
Product Categories/Family for anti-TACC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
transforming acidic coiled-coil-containing protein 3
NCBI Official Synonym Full Names
transforming acidic coiled-coil containing protein 3
NCBI Official Symbol
TACC3
NCBI Official Synonym Symbols
ERIC1; ERIC-1
NCBI Protein Information
transforming acidic coiled-coil-containing protein 3
UniProt Protein Name
Transforming acidic coiled-coil-containing protein 3
UniProt Gene Name
TACC3
UniProt Synonym Gene Names
ERIC1
UniProt Entry Name
TACC3_HUMAN

NCBI Description

This gene encodes a member of the transforming acidic colied-coil protein family. The encoded protein is a motor spindle protein that may play a role in stabilization of the mitotic spindle. This protein may also play a role in growth a differentiation of certain cancer cells. [provided by RefSeq, Nov 2011]

Uniprot Description

TACC3: Plays a role in the microtubule-dependent coupling of the nucleus and the centrosome. Involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors. May be involved in the control of cell growth and differentiation. May contribute to cancer. Interacts with microtubules. Interacts with CCDC100/CEP120. The coiled coil C-terminus region interacts with AH receptor nuclear translocator protein (ARNT) and ARNT2. Interacts with GCN5L2 and PCAF. Up-regulated in various cancer cell lines. Belongs to the TACC family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: centrosome; cytoplasm

Molecular Function: protein domain specific binding; protein binding

Biological Process: cell proliferation; regulation of microtubule-based process; cytoplasmic sequestering of transcription factor; astral microtubule organization and biogenesis; neurogenesis; regulation of cell cycle; response to hypoxia; hemopoiesis; microtubule cytoskeleton organization and biogenesis; cerebral cortex development; interkinetic nuclear migration

Disease: Bladder Cancer

Research Articles on TACC3

Similar Products

Product Notes

The TACC3 tacc3 (Catalog #AAA3210636) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TACC3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TACC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TACC3 tacc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGSEPVPTHQ QGQPALELKE ESFRDPAEVL GTGAEVDYLE QFGTSSFKES. It is sometimes possible for the material contained within the vial of "TACC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.