Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human SYT9 Polyclonal Antibody | anti-SYT9 antibody

SYT9 Rabbit pAb

Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
SYT9; Polyclonal Antibody; SYT9 Rabbit pAb; anti-SYT9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
VPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAK
Applicable Applications for anti-SYT9 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human SYT9 (NP_783860.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,188 Da
NCBI Official Full Name
synaptotagmin-9
NCBI Official Synonym Full Names
synaptotagmin IX
NCBI Official Symbol
SYT9
NCBI Protein Information
synaptotagmin-9; sytIX
UniProt Protein Name
Synaptotagmin-9
Protein Family
UniProt Gene Name
SYT9
UniProt Synonym Gene Names
SytIX
UniProt Entry Name
SYT9_HUMAN

Uniprot Description

Function: May be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.

Cofactor: Binds 3 calcium ions per subunit. The ions are bound to the C2 domains

By similarity.

Subcellular location: Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Single-pass membrane protein

By similarity.

Sequence similarities: Belongs to the synaptotagmin family.Contains 2 C2 domains.

Research Articles on SYT9

Similar Products

Product Notes

The SYT9 syt9 (Catalog #AAA9142687) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYT9 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYT9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SYT9 syt9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPWRERGLPS GSKDNNQEPL NYMDTETNEQ ENSEDFLDPP TPCPDSSMKI SHTSPDIPLS TQTGIQENCA HGVRVQRQVT EPTSSARHNS IRRQLNLSNP DFNIQQLQKQ EQLTGIGRIK PELYKQRSLD NDDGRRSNSK ACGKLNFILK YDCDLEQLIV KIHKAVNLPA K. It is sometimes possible for the material contained within the vial of "SYT9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.