Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SYNJ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Rat SYNJ1 Polyclonal Antibody | anti-SYNJ1 antibody

SYNJ1 Rabbit pAb

Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
SYNJ1; Polyclonal Antibody; SYNJ1 Rabbit pAb; EIEE53; INPP5G; PARK20; anti-SYNJ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
Applicable Applications for anti-SYNJ1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SYNJ1 (NP_003886.3).
Positive Samples
Jurkat, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SYNJ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SYNJ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-SYNJ1 antibody
Background: This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4, 5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
Observed MW: 140kDa
UniProt Protein Name
Synaptojanin-1
Protein Family
UniProt Gene Name
SYNJ1
UniProt Synonym Gene Names
KIAA0910
UniProt Entry Name
SYNJ1_HUMAN

Uniprot Description

SYNJ1: Inositol 5-phosphatase which has a role in clathrin- mediated endocytosis. Belongs to the synaptojanin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - inositol phosphate; Phosphatase, lipid; Motility/polarity/chemotaxis; Vesicle; EC 3.1.3.36

Chromosomal Location of Human Ortholog: 21q22.2

Cellular Component: membrane coat; cytosol

Molecular Function: RNA binding; phosphoinositide 5-phosphatase activity; nucleotide binding; inositol-polyphosphate 5-phosphatase activity

Biological Process: inositol phosphate metabolic process; neurotransmitter transport; phospholipid metabolic process; inositol phosphate dephosphorylation; synaptic vesicle endocytosis; phosphatidylinositol biosynthetic process; synaptic vesicle transport; phosphoinositide dephosphorylation; synaptic vesicle uncoating; phosphatidylinositol metabolic process; synaptic vesicle priming; phosphate metabolic process

Disease: Parkinson Disease 20, Early-onset

Similar Products

Product Notes

The SYNJ1 synj1 (Catalog #AAA9142854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYNJ1 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYNJ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SYNJ1 synj1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GLLGVLRLNL GDTMLHYLVL VTGCMSVGKI QESEVFRVTS TEFISLRIDS SDEDRISEVR KVLNSGNFYF AWSASGISLD LSLNAHRSMQ EQTTDNRFFW N. It is sometimes possible for the material contained within the vial of "SYNJ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.