Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SYK AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit SYK Polyclonal Antibody | anti-SYK antibody

SYK antibody - middle region

Gene Names
SYK; p72-Syk
Reactivity
Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SYK; Polyclonal Antibody; SYK antibody - middle region; anti-SYK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREAL
Sequence Length
635
Applicable Applications for anti-SYK antibody
Western Blot (WB)
Homology
Horse: 85%; Human: 100%; Pig: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SYK AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-SYK AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-SYK antibody
This is a rabbit polyclonal antibody against SYK. It was validated on Western Blot

Target Description: This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SYK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
tyrosine-protein kinase SYK isoform Syk(L)
NCBI Official Synonym Full Names
spleen associated tyrosine kinase
NCBI Official Symbol
SYK
NCBI Official Synonym Symbols
p72-Syk
NCBI Protein Information
tyrosine-protein kinase SYK
UniProt Protein Name
Tyrosine-protein kinase SYK
Protein Family
UniProt Gene Name
SYK
UniProt Entry Name
KSYK_HUMAN

NCBI Description

This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

Syk: a cytoplasmic tyrosine kinase of the SYK family containing two SH2 domains. Plays a central role in the B cell receptor (BCR) response. An upstream activator of the PI3K, PLCgamma2, and Rac/cdc42 pathways in the BCR response. Required for the sequential events of Fc gamma IIa receptor-mediated phagocytosis. Expression highest in murine spleen, heart, mammary gland and thymus. Two splice variant isoforms have been described.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (non-receptor); Kinase, protein; EC 2.7.10.2; TK group; Syk family

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: T cell receptor complex; extrinsic to internal side of plasma membrane; protein complex; cytoplasm; plasma membrane; nucleus; cytosol; B cell receptor complex

Molecular Function: integrin binding; protein serine/threonine kinase activity; protein binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; protein kinase binding; ATP binding; protein kinase activity

Biological Process: viral reproduction; transcription factor import into nucleus; positive regulation of interleukin-3 biosynthetic process; positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; positive regulation of calcium-mediated signaling; regulation of phagocytosis; protein amino acid phosphorylation; activation of JNK activity; leukocyte adhesion; B cell receptor signaling pathway; regulation of transcription factor activity; positive regulation of bone resorption; beta selection; positive regulation of gamma-delta T cell differentiation; angiogenesis; inflammatory response; integrin-mediated signaling pathway; neutrophil chemotaxis; platelet activation; adaptive immune response; regulation of superoxide release; positive regulation of cell adhesion mediated by integrin; positive regulation of mast cell degranulation; regulation of neutrophil degranulation; leukotriene biosynthetic process; cell proliferation; organ morphogenesis; neutrophil activation during immune response; positive regulation of peptidyl-tyrosine phosphorylation; leukocyte activation during immune response; serotonin secretion by platelet; defense response to bacterium; macrophage activation during immune response; positive regulation of B cell differentiation; blood vessel morphogenesis; innate immune response; positive regulation of alpha-beta T cell proliferation; blood coagulation; lymph vessel development; positive regulation of alpha-beta T cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cytokine secretion

Research Articles on SYK

Similar Products

Product Notes

The SYK syk (Catalog #AAA3215079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYK antibody - middle region reacts with Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SYK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYK syk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIKSYSFPKP GHRKSSPAQG NRQESTVSFN PYEPELAPWA ADKGPQREAL. It is sometimes possible for the material contained within the vial of "SYK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.