<
Western Blot (WB)
(Host: RabbitTarget Name: SYDE1Sample Type: HelaAntibody Dilution: 1.0ug/mlSYDE1 is supported by BioGPS gene expression data to be expressed in HeLa)
Rabbit SYDE1 Polyclonal Antibody | anti-SYDE1 antibody
SYDE1 antibody - C-terminal region
Gene Names
SYDE1; 7h3; SYD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SYDE1; Polyclonal Antibody; SYDE1 antibody - C-terminal region; anti-SYDE1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL
Sequence Length
735
Applicable Applications for anti-SYDE1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SYDE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SYDE1Sample Type: HelaAntibody Dilution: 1.0ug/mlSYDE1 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: SYDE1Sample Type: HelaAntibody Dilution: 1.0ug/mlSYDE1 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(Host: RabbitTarget Name: SYDE1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SYDE1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Lanes:1: 2ug mouse SYDE1 transfected HEK293T lysate, 2: 15ug untransfected HEK293T lysate, 3: 100ug wild type mouse brain lysate, 4: 100ug SYDE1 knock-out mouse brain lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit L-chain HRPSecondary Antibody Dilution:1:10,000Gene Name:SYDE1Submitted by:Anonymous)
Western Blot (WB)
(Lanes:1: 2ug mouse SYDE1 transfected HEK293T lysate, 2: 15ug untransfected HEK293T lysate, 3: 100ug wild type mouse brain lysate, 4: 100ug SYDE1 knock-out mouse brain lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit L-chain HRPSecondary Antibody Dilution:1:10,000Gene Name:SYDE1Submitted by:Anonymous)
Western Blot (WB)
(WB Suggested Anti-SYDE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateSYDE1 is supported by BioGPS gene expression data to be expressed in HeLa)
Western Blot (WB)
(WB Suggested Anti-SYDE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateSYDE1 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-SYDE1 antibody
This is a rabbit polyclonal antibody against SYDE1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Target Description: SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Product Categories/Family for anti-SYDE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
rho GTPase-activating protein SYDE1 isoform 1
NCBI Official Synonym Full Names
synapse defective Rho GTPase homolog 1
NCBI Official Symbol
SYDE1
NCBI Official Synonym Symbols
7h3; SYD1
NCBI Protein Information
rho GTPase-activating protein SYDE1
UniProt Protein Name
Rho GTPase-activating protein SYDE1
Protein Family
UniProt Gene Name
SYDE1
UniProt Synonym Gene Names
Protein syd-1 homolog 1
UniProt Entry Name
SYDE1_HUMAN
NCBI Description
The protein encoded by this gene is a Rho GTPase-activating protein highly expressed in placenta. The encoded protein is involved in cytoskeletal remodeling and trophoblast cell migration. Decreased expression of this gene has been associated with intrauterine growth restriction (IUGR). [provided by RefSeq, Feb 2017]
Research Articles on SYDE1
Similar Products
Product Notes
The SYDE1 syde1 (Catalog #AAA3206506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYDE1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYDE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYDE1 syde1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PYLRPKRQPP LHLPLADPEV VTRPRGRGGP ESPPSNRYAG DWSVCGRDFL. It is sometimes possible for the material contained within the vial of "SYDE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
