Western Blot (WB)
(Host: RabbitTarget Name: SURF4Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Rabbit SURF4 Polyclonal Antibody | anti-SURF4 antibody
SURF4 antibody - N-terminal region
Gene Names
SURF4; ERV29
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SURF4; Polyclonal Antibody; SURF4 antibody - N-terminal region; anti-SURF4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ
Sequence Length
269
Applicable Applications for anti-SURF4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SURF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SURF4Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SURF4Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-SURF4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-SURF4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-SURF4 antibody
This is a rabbit polyclonal antibody against SURF4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles. This gene is located in the surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity. The encoded protein is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles. This gene uses multiple polyadenylation sites, resulting in transcript length variation. The existence of alternatively spliced transcript variants has been suggested, but their validity has not been determined.
Target Description: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles. This gene is located in the surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity. The encoded protein is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles. This gene uses multiple polyadenylation sites, resulting in transcript length variation. The existence of alternatively spliced transcript variants has been suggested, but their validity has not been determined.
Product Categories/Family for anti-SURF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
surfeit locus protein 4 isoform 1
NCBI Official Synonym Full Names
surfeit 4
NCBI Official Symbol
SURF4
NCBI Official Synonym Symbols
ERV29
NCBI Protein Information
surfeit locus protein 4
UniProt Protein Name
Surfeit locus protein 4
Protein Family
UniProt Gene Name
SURF4
UniProt Synonym Gene Names
SURF-4
NCBI Description
This gene is located in the surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity. The encoded protein is a conserved integral membrane protein that interacts with endoplasmic reticulum-Golgi intermediate compartment proteins. Disruption of this gene results in reduced numbers of endoplasmic reticulum-Golgi intermediate compartment clusters and redistribution of coat protein I to the cytosol. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Uniprot Description
May play a role in the maintenance of the architecture of the endoplasmic reticulum-Golgi intermediate compartment and of the Golgi.
Research Articles on SURF4
Similar Products
Product Notes
The SURF4 surf4 (Catalog #AAA3209819) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SURF4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SURF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SURF4 surf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQNDLMGTAE DFADQFLRVT KQYLPHVARL CLISTFLEDG IRMWFQWSEQ. It is sometimes possible for the material contained within the vial of "SURF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
