Western Blot (WB)
(Host: RabbitTarget Name: ST65GSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human SUPT7L Polyclonal Antibody | anti-SUPT7L antibody
SUPT7L Antibody - C-terminal region
Gene Names
SUPT7L; SPT7L; STAF65; SUPT7H; STAF65G; STAF65(gamma)
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SUPT7L; Polyclonal Antibody; SUPT7L Antibody - C-terminal region; anti-SUPT7L antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGHGVLGSDVFEEPMSGMSEAGIPQSPDDSDSSYGSHSTDSLMGSSPVFN
Sequence Length
414
Applicable Applications for anti-SUPT7L antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ST65G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ST65GSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ST65GSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SUPT7L antibody
This is a rabbit polyclonal antibody against ST65G. It was validated on Western Blot
Target Description: SUPT7L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr 2009]
Target Description: SUPT7L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr 2009]
Product Categories/Family for anti-SUPT7L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
STAGA complex 65 subunit gamma isoform a
NCBI Official Synonym Full Names
SPT7 like, STAGA complex gamma subunit
NCBI Official Symbol
SUPT7L
NCBI Official Synonym Symbols
SPT7L; STAF65; SUPT7H; STAF65G; STAF65(gamma)
NCBI Protein Information
STAGA complex 65 subunit gamma
UniProt Protein Name
STAGA complex 65 subunit gamma
Protein Family
UniProt Gene Name
SUPT7L
UniProt Synonym Gene Names
KIAA0764; STAF65gamma
UniProt Entry Name
ST65G_HUMAN
NCBI Description
SUPT7L is a protein subunit of the human STAGA complex (SPT3; (MIM 602947)/TAF9 (MIM 600822)/GCN5 (MIM 602301) acetyltransferase complex), which is a chromatin-modifying multiprotein complex (Martinez et al., 2001 [PubMed 11564863]).[supplied by OMIM, Apr 2009]
Research Articles on SUPT7L
Similar Products
Product Notes
The SUPT7L supt7l (Catalog #AAA3219980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUPT7L Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUPT7L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SUPT7L supt7l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGHGVLGSDV FEEPMSGMSE AGIPQSPDDS DSSYGSHSTD SLMGSSPVFN. It is sometimes possible for the material contained within the vial of "SUPT7L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
