Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SULT1A2Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SULT1A2 Polyclonal Antibody | anti-SULT1A2 antibody

SULT1A2 Antibody - middle region

Gene Names
SULT1A2; STP2; HAST4; P-PST; ST1A2; TSPST2; P-PST 2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SULT1A2; Polyclonal Antibody; SULT1A2 Antibody - middle region; anti-SULT1A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVE
Sequence Length
295
Applicable Applications for anti-SULT1A2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SULT1A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SULT1A2Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SULT1A2Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SULT1A2 antibody
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described.
Product Categories/Family for anti-SULT1A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
sulfotransferase 1A2 isoform 1
NCBI Official Synonym Full Names
sulfotransferase family 1A member 2
NCBI Official Symbol
SULT1A2
NCBI Official Synonym Symbols
STP2; HAST4; P-PST; ST1A2; TSPST2; P-PST 2
NCBI Protein Information
sulfotransferase 1A2
UniProt Protein Name
Sulfotransferase 1A1
Protein Family
UniProt Gene Name
SULT1A1
UniProt Synonym Gene Names
STP; STP1; ST1A1; P-PST 1; Ts-PST
UniProt Entry Name
ST1A1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Two alternatively spliced variants that encode the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT1A1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N- hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.8.2.1; Energy Metabolism - sulfur; Transferase

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; steroid sulfotransferase activity; flavonol 3-sulfotransferase activity; aryl sulfotransferase activity

Biological Process: estrogen metabolic process; flavonoid metabolic process; xenobiotic metabolic process; sulfation; catecholamine metabolic process; amine metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on SULT1A2

Similar Products

Product Notes

The SULT1A2 sult1a1 (Catalog #AAA3222504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SULT1A2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SULT1A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SULT1A2 sult1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQEWWELSRT HPVLYLFYED MKENPKREIQ KILEFVGRSL PEETVDLMVE. It is sometimes possible for the material contained within the vial of "SULT1A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.