Rabbit anti-Human SUGT1 Polyclonal Antibody | anti-SUGT1 antibody

SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3) APC

Cat. Num. AAA6395599

• Gene Names: SUGT1; SGT1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SUGT1; Polyclonal Antibody; SUGT1 (Suppressor of G2 Allele of SKP1 Homolog; Sgt1; Protein 40-6-3) APC; anti-SUGT1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SUGT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 333

• Applicable Applications for anti-SUGT1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SUGT1, aa1-333 (NP_006695.1).
• Immunogen Sequence: MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SUGT1 expression in transfected 293T cell line by SUGT1 polyclonal antibody. Lane 1: SUGT1 transfected lysate (37.8kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SUGT1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5730041
• NCBI GeneID: 10910
• NCBI Accession #: NP_006695.1
• NCBI GenBank Nucleotide #: NM_006704
• UniProt Accession #: Q9Y2Z0
• NCBI Official Full Name: protein SGT1 homolog isoform A
• NCBI Official Synonym Full Names: SGT1 homolog, MIS12 kinetochore complex assembly cochaperone
• NCBI Official Symbol: SUGT1
• NCBI Official Synonym Symbols: SGT1
• NCBI Protein Information: protein SGT1 homolog
• UniProt Protein Name: Suppressor of G2 allele of SKP1 homolog
• UniProt Gene Name: SUGT1
• UniProt Entry Name: SUGT1_HUMAN

NCBI Description

This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016]

Uniprot Description

SUGT1: a protein involved in kinetochore function and required for the G1/S and G2/M transitions. A subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Two alternatively spliced isoforms have been reported.

Protein type: Ubiquitin conjugating system; Cell cycle regulation

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: kinetochore; cytoplasm; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding

Biological Process: mitosis; innate immune response