Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit STX4 Polyclonal Antibody | anti-STX4 antibody

STX4 antibody - C-terminal region

Gene Names
STX4; STX4A; p35-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STX4; Polyclonal Antibody; STX4 antibody - C-terminal region; anti-STX4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV
Sequence Length
297
Applicable Applications for anti-STX4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 91%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-STX4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-STX4 antibody
This is a rabbit polyclonal antibody against STX4. It was validated on Western Blot

Target Description: STX4 is a plasma membrane t-SNARE that mediates docking of transport vesicles.STX4 is necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, STX4 may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes . STX4 may also play a role in docking of synaptic vesicles at presynaptic active zones.
Product Categories/Family for anti-STX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
syntaxin-4 isoform 3
NCBI Official Synonym Full Names
syntaxin 4
NCBI Official Symbol
STX4
NCBI Official Synonym Symbols
STX4A; p35-2
NCBI Protein Information
syntaxin-4
UniProt Protein Name
Syntaxin-4
UniProt Gene Name
STX4
UniProt Synonym Gene Names
STX4A
UniProt Entry Name
STX4_HUMAN

Uniprot Description

STX4: a protein of the syntaxin/epimorphin family. Contains 1 t-SNARE coiled-coil homology domain. Potentially involved in docking of synaptic vesicles at presynaptic active zones. Interacts with SNAP23 and SNAP25BP. Found in a complex with VAMP8 and SNAP23 in pancreas.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: extracellular space; specific granule; cell surface; lateral loop; basolateral plasma membrane; integral to membrane; dendritic spine; trans-Golgi network; cytosol; SNARE complex; synaptic vesicle; membrane; perinuclear region of cytoplasm; lamellipodium; plasma membrane; vacuole; synapse; intracellular; endosome

Molecular Function: sphingomyelin phosphodiesterase activator activity; SNAP receptor activity; SNARE binding; protein binding

Biological Process: positive regulation of catalytic activity; platelet activation; positive regulation of cell adhesion; organelle fusion; positive regulation of eosinophil degranulation; positive regulation of chemotaxis; positive regulation of immunoglobulin secretion; synaptic vesicle fusion to presynaptic membrane; regulation of exocytosis; intracellular protein transport; response to hydroperoxide; vesicle docking; positive regulation of cell proliferation; post-Golgi vesicle-mediated transport; blood coagulation; positive regulation of cell migration

Research Articles on STX4

Similar Products

Product Notes

The STX4 stx4 (Catalog #AAA3214383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STX4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STX4 stx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEMQGEMINR IEKNILSSAD YVERGQEHVK TALENQKKAR KKKVLIAICV. It is sometimes possible for the material contained within the vial of "STX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.