Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human STX2 Polyclonal Antibody | anti-STX2 antibody

STX2 (Epimorphin, Syntaxin-2, EPIM, STX2A, STX2B, STX2C) (MaxLight 750)

Gene Names
STX2; EPM; EPIM; STX2A; STX2B; STX2C
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STX2; Polyclonal Antibody; STX2 (Epimorphin; Syntaxin-2; EPIM; STX2A; STX2B; STX2C) (MaxLight 750); anti-STX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-STX2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human STX2, aa1-287 (NP_001971.2).
Immunogen Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-STX2 antibody
Essential for epithelial morphogenesis. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm.
Product Categories/Family for anti-STX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,425 Da
NCBI Official Full Name
syntaxin-2 isoform 1
NCBI Official Synonym Full Names
syntaxin 2
NCBI Official Symbol
STX2
NCBI Official Synonym Symbols
EPM; EPIM; STX2A; STX2B; STX2C
NCBI Protein Information
syntaxin-2; epimorphin
UniProt Protein Name
Syntaxin-2
Protein Family
UniProt Gene Name
STX2
UniProt Synonym Gene Names
EPIM; STX2A; STX2B; STX2C
UniProt Entry Name
STX2_HUMAN

NCBI Description

The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

STX2: Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm. Belongs to the syntaxin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24.33

Cellular Component: SNARE complex; extracellular space; synaptic vesicle; cell surface; intracellular membrane-bound organelle; lamellipodium; basolateral plasma membrane; integral to membrane; plasma membrane; endomembrane system; intercellular junction; lipid raft

Molecular Function: protein dimerization activity; SNAP receptor activity; SNARE binding; protein binding; calcium-dependent protein binding

Biological Process: synaptic vesicle fusion to presynaptic membrane; intracellular protein transport; organ morphogenesis; vesicle docking; response to hydroperoxide; acrosome reaction; regulation of blood coagulation; ectoderm development; signal transduction; cell differentiation; protein oligomerization; regulation of cytoskeleton organization and biogenesis

Research Articles on STX2

Similar Products

Product Notes

The STX2 stx2 (Catalog #AAA6395541) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX2 (Epimorphin, Syntaxin-2, EPIM, STX2A, STX2B, STX2C) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STX2 stx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.